NTDB

Overview

Name	pilA	Type	Machinery gene
Locus tag	PSH71_RS25760	Genome accession	NZ_CP117457
Coordinates	5784794..5785219 (-)	Length	141 a.a.
NCBI ID	WP_013694230.1	Uniprot ID	A0AAD1GWQ3
Organism	Pseudomonas brassicacearum strain FP1843
Function	assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 5779794..5790219

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PSH71_RS25745 (PSH71_25740)	-	5780608..5783541 (+)	2934	WP_039014135.1	DUF748 domain-containing protein	-
PSH71_RS25750 (PSH71_25745)	-	5783543..5783839 (+)	297	WP_013694228.1	DUF2845 domain-containing protein	-
PSH71_RS25755 (PSH71_25750)	-	5784168..5784521 (-)	354	WP_003205664.1	BON domain-containing protein	-
PSH71_RS25760 (PSH71_25755)	pilA	5784794..5785219 (-)	426	WP_013694230.1	pilin	Machinery gene
PSH71_RS25765 (PSH71_25760)	pilB	5785444..5787144 (+)	1701	WP_003205669.1	type IV-A pilus assembly ATPase PilB	Machinery gene
PSH71_RS25770 (PSH71_25765)	pilC	5787147..5788364 (+)	1218	WP_003205670.1	type II secretion system F family protein	Machinery gene
PSH71_RS25775 (PSH71_25770)	pilD	5788366..5789235 (+)	870	WP_305441614.1	A24 family peptidase	Machinery gene
PSH71_RS25780 (PSH71_25775)	coaE	5789235..5789858 (+)	624	WP_003205673.1	dephospho-CoA kinase	-
PSH71_RS25785 (PSH71_25780)	yacG	5789855..5790061 (+)	207	WP_003205675.1	DNA gyrase inhibitor YacG	-

Sequence

Protein

Download Length: 141 a.a. Molecular weight: 14175.29 Da Isoelectric Point: 7.5917

                                >NTDB_id=785618 PSH71_RS25760 WP_013694230.1 5784794..5785219(-) (pilA) [Pseudomonas brassicacearum strain FP1843]

MNKQSGFTLIELLIVVAIIGILATFALPQYSKYQARAKATAGLAEVSALKVPFEDIMNQGTNPTLANIGGTSPTSNCTLT

ASGTAADGAGTIACTLLNAPAPVLGKAITLTRSTQGVWTCGSTAAQEFLPAGCTGTAATTP

Nucleotide

Download Length: 426 bp

                                >NTDB_id=785618 PSH71_RS25760 WP_013694230.1 5784794..5785219(-) (pilA) [Pseudomonas brassicacearum strain FP1843]

ATGAATAAGCAGAGTGGCTTTACCTTGATCGAGCTGCTGATCGTCGTGGCGATCATCGGTATTCTGGCGACGTTTGCGTT

GCCGCAATATTCGAAGTATCAGGCGCGGGCCAAGGCCACGGCGGGGCTGGCGGAGGTCTCTGCGTTGAAAGTGCCGTTTG

AGGACATCATGAATCAAGGTACCAATCCAACGTTGGCCAACATCGGCGGGACCTCGCCCACCAGCAATTGCACCTTGACG

GCTTCAGGAACAGCAGCGGACGGAGCGGGCACCATCGCGTGTACCCTTTTGAATGCACCCGCTCCAGTGCTTGGCAAAGC

GATCACCCTGACGCGTTCTACTCAAGGCGTTTGGACCTGCGGTTCGACCGCCGCTCAGGAATTCCTGCCGGCTGGATGCA

CAGGTACAGCAGCGACGACTCCGTAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(1-27)

Pilin (bacterial filament) (Pilin)

(35-134)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
pilA	Acinetobacter baumannii strain A118	50.725	97.872	0.496
pilA/pilAI	Pseudomonas stutzeri DSM 10701	46.715	97.163	0.454
pilA/pilAII	Pseudomonas stutzeri DSM 10701	43.284	95.035	0.411
pilA	Pseudomonas aeruginosa PAK	38.926	100	0.411
comP	Acinetobacter baylyi ADP1	37.748	100	0.404
pilA2	Legionella pneumophila strain ERS1305867	39.855	97.872	0.39
pilA2	Legionella pneumophila str. Paris	39.855	97.872	0.39
pilA	Ralstonia pseudosolanacearum GMI1000	33.54	100	0.383
pilA	Vibrio cholerae C6706	37.063	100	0.376
pilA	Vibrio cholerae strain A1552	37.063	100	0.376
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	37.063	100	0.376
pilA	Vibrio parahaemolyticus RIMD 2210633	39.844	90.78	0.362

Detailed information NTG0785618