NTDB

Overview

Name	comYC	Type	Machinery gene
Locus tag	O6R09_RS00690	Genome accession	NZ_CP114883
Coordinates	103143..103436 (+)	Length	97 a.a.
NCBI ID	WP_235280789.1	Uniprot ID	-
Organism	Streptococcus alactolyticus strain LGM
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 98143..108436

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
O6R09_RS00675 (O6R09_00675)	-	100795..101103 (+)	309	WP_154454148.1	DUF1033 family protein	-
O6R09_RS00680 (O6R09_00680)	comGA/cglA	101235..102176 (+)	942	WP_269725665.1	competence type IV pilus ATPase ComGA	Machinery gene
O6R09_RS00685 (O6R09_00685)	comYB	102058..103143 (+)	1086	WP_374041727.1	competence type IV pilus assembly protein ComGB	Machinery gene
O6R09_RS00690 (O6R09_00690)	comYC	103143..103436 (+)	294	WP_235280789.1	competence type IV pilus major pilin ComGC	Machinery gene
O6R09_RS00695 (O6R09_00695)	comGD	103399..103851 (+)	453	WP_154454146.1	competence type IV pilus minor pilin ComGD	-
O6R09_RS00700 (O6R09_00700)	comGE	103874..104098 (+)	225	WP_154454160.1	competence type IV pilus minor pilin ComGE	-
O6R09_RS00705 (O6R09_00705)	comYF	104058..104519 (+)	462	WP_269725666.1	competence type IV pilus minor pilin ComGF	Machinery gene
O6R09_RS00710 (O6R09_00710)	comGG	104491..104817 (+)	327	WP_154454144.1	competence type IV pilus minor pilin ComGG	-
O6R09_RS00715 (O6R09_00715)	comYH	104892..105848 (+)	957	WP_154454143.1	class I SAM-dependent methyltransferase	Machinery gene
O6R09_RS00720 (O6R09_00720)	-	105900..107114 (+)	1215	WP_154454142.1	acetate kinase	-
O6R09_RS00725 (O6R09_00725)	-	107235..107873 (+)	639	WP_154454141.1	CPBP family intramembrane glutamic endopeptidase	-

Sequence

Protein

Download Length: 97 a.a. Molecular weight: 11178.24 Da Isoelectric Point: 10.4724

                                >NTDB_id=767308 O6R09_RS00690 WP_235280789.1 103143..103436(+) (comYC) [Streptococcus alactolyticus strain LGM]

MKNRLAKWRRKTVRGFTLVEMLIVLLIISVLMLLFVPNLSNQKDAVREKGNKAVVKVVESQLSLYELKEGEKPSIEQLVK

AGYITDDQAETYRKTKQ

Nucleotide

Download Length: 294 bp

                                >NTDB_id=767308 O6R09_RS00690 WP_235280789.1 103143..103436(+) (comYC) [Streptococcus alactolyticus strain LGM]

ATGAAAAATAGATTAGCTAAATGGCGTAGAAAGACTGTTCGTGGATTCACTCTGGTGGAAATGTTAATTGTTTTGCTTAT

TATTAGCGTTTTGATGTTGCTTTTTGTACCAAATTTAAGCAATCAAAAAGATGCGGTGCGTGAAAAAGGTAACAAGGCAG

TGGTCAAGGTGGTAGAAAGTCAGCTATCGCTTTATGAACTCAAAGAAGGTGAGAAACCAAGCATTGAACAACTTGTTAAA

GCGGGTTATATTACAGATGATCAAGCCGAAACCTATCGCAAAACTAAGCAATAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(11-34)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comYC	Streptococcus gordonii str. Challis substr. CH1	61.957	94.845	0.588
comGC/cglC	Streptococcus mitis SK321	56.522	94.845	0.536
comGC/cglC	Streptococcus pneumoniae D39	55.914	95.876	0.536
comGC/cglC	Streptococcus pneumoniae R6	55.914	95.876	0.536
comGC/cglC	Streptococcus pneumoniae TIGR4	55.914	95.876	0.536
comGC/cglC	Streptococcus mitis NCTC 12261	55.914	95.876	0.536
comGC/cglC	Streptococcus pneumoniae Rx1	55.914	95.876	0.536
comYC	Streptococcus suis isolate S10	61.176	87.629	0.536
comYC	Streptococcus mutans UA140	56.18	91.753	0.515
comYC	Streptococcus mutans UA159	56.18	91.753	0.515
comGC	Lactococcus lactis subsp. cremoris KW2	54.023	89.691	0.485
comGC	Staphylococcus aureus MW2	45.783	85.567	0.392
comGC	Staphylococcus aureus N315	45.783	85.567	0.392

Detailed information NTG0767308