Detailed information
Bioinformatically predicted
Overview
| Name | pilA/pilAI | Type | Machinery gene |
| Locus tag | NYR99_RS17115 | Genome accession | NZ_CP103840 |
| Coordinates | 3923172..3923570 (-) | Length | 132 a.a. |
| NCBI ID | WP_316687920.1 | Uniprot ID | - |
| Organism | Xanthomonas dyei strain 22-325 | ||
| Function | assembly of type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 3914943..3951804 | 3923172..3923570 | within | 0 |
Gene organization within MGE regions
Location: 3914943..3951804
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYR99_RS17075 (NYR99_17040) | - | 3914943..3915794 (+) | 852 | WP_316687912.1 | glycosyltransferase family 2 protein | - |
| NYR99_RS17080 (NYR99_17045) | - | 3915846..3916706 (+) | 861 | WP_316687913.1 | glycosyltransferase family 2 protein | - |
| NYR99_RS17085 (NYR99_17050) | - | 3916691..3917866 (+) | 1176 | WP_316687914.1 | glycosyltransferase | - |
| NYR99_RS17090 (NYR99_17055) | - | 3917860..3918702 (+) | 843 | WP_316687915.1 | glycosyltransferase | - |
| NYR99_RS17095 (NYR99_17060) | - | 3918705..3919631 (-) | 927 | WP_316687916.1 | glycosyltransferase family 9 protein | - |
| NYR99_RS17100 (NYR99_17065) | - | 3919888..3920646 (-) | 759 | WP_316687917.1 | class I SAM-dependent methyltransferase | - |
| NYR99_RS17105 (NYR99_17070) | - | 3920770..3922590 (-) | 1821 | WP_316687918.1 | hypothetical protein | - |
| NYR99_RS17110 (NYR99_17075) | - | 3922649..3923071 (-) | 423 | WP_316687919.1 | pilin | - |
| NYR99_RS17115 (NYR99_17085) | pilA/pilAI | 3923172..3923570 (-) | 399 | WP_316687920.1 | pilin | Machinery gene |
| NYR99_RS17120 (NYR99_17090) | pilC | 3923921..3925183 (+) | 1263 | WP_316687921.1 | type II secretion system F family protein | Machinery gene |
| NYR99_RS17125 (NYR99_17095) | - | 3925190..3926053 (+) | 864 | WP_115513691.1 | A24 family peptidase | - |
| NYR99_RS17130 (NYR99_17100) | coaE | 3926067..3926687 (+) | 621 | WP_316687922.1 | dephospho-CoA kinase | - |
| NYR99_RS17135 (NYR99_17105) | - | 3926841..3931622 (+) | 4782 | WP_316687923.1 | RHS repeat-associated core domain-containing protein | - |
| NYR99_RS17140 (NYR99_17110) | - | 3932259..3932662 (+) | 404 | Protein_3274 | SymE family type I addiction module toxin | - |
| NYR99_RS17145 (NYR99_17115) | - | 3932738..3933028 (+) | 291 | WP_228325572.1 | DUF1778 domain-containing protein | - |
| NYR99_RS17150 (NYR99_17120) | - | 3933025..3933516 (+) | 492 | WP_316687924.1 | GNAT family N-acetyltransferase | - |
| NYR99_RS17155 (NYR99_17125) | - | 3933661..3934995 (-) | 1335 | WP_316687925.1 | HAMP domain-containing sensor histidine kinase | - |
| NYR99_RS17160 (NYR99_17130) | - | 3934988..3935665 (-) | 678 | WP_003490678.1 | response regulator transcription factor | - |
| NYR99_RS17165 (NYR99_17135) | - | 3935684..3936268 (-) | 585 | WP_316688070.1 | hypothetical protein | - |
| NYR99_RS17170 (NYR99_17140) | rimK | 3936372..3937277 (-) | 906 | WP_167455844.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
| NYR99_RS17175 (NYR99_17145) | glgX | 3937745..3939877 (+) | 2133 | WP_316688074.1 | glycogen debranching protein GlgX | - |
| NYR99_RS17180 (NYR99_17150) | - | 3940432..3940824 (-) | 393 | WP_104617555.1 | H-NS family nucleoid-associated regulatory protein | - |
| NYR99_RS17185 (NYR99_17155) | - | 3940913..3941305 (-) | 393 | WP_316688076.1 | hypothetical protein | - |
| NYR99_RS17190 (NYR99_17160) | - | 3941848..3942393 (-) | 546 | WP_104617557.1 | hypothetical protein | - |
| NYR99_RS17195 (NYR99_17165) | - | 3942563..3942847 (+) | 285 | WP_316688080.1 | hypothetical protein | - |
| NYR99_RS17200 (NYR99_17170) | - | 3943456..3943797 (+) | 342 | WP_316688082.1 | hypothetical protein | - |
| NYR99_RS17205 (NYR99_17175) | - | 3943862..3944143 (+) | 282 | WP_228325566.1 | DUF6516 family protein | - |
| NYR99_RS17210 (NYR99_17180) | - | 3944151..3944519 (+) | 369 | WP_316688084.1 | transcriptional regulator | - |
| NYR99_RS17215 (NYR99_17185) | - | 3944593..3945228 (-) | 636 | Protein_3289 | hypothetical protein | - |
| NYR99_RS17220 (NYR99_17190) | - | 3945298..3946400 (+) | 1103 | WP_316688085.1 | IS3 family transposase | - |
| NYR99_RS17225 (NYR99_17195) | - | 3946601..3947278 (+) | 678 | WP_316688086.1 | hypothetical protein | - |
| NYR99_RS17230 (NYR99_17200) | - | 3947500..3948990 (+) | 1491 | WP_316688088.1 | hypothetical protein | - |
| NYR99_RS17235 (NYR99_17205) | - | 3949309..3950118 (-) | 810 | WP_316688091.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 132 a.a. Molecular weight: 13694.95 Da Isoelectric Point: 8.8372
>NTDB_id=725904 NYR99_RS17115 WP_316687920.1 3923172..3923570(-) (pilA/pilAI) [Xanthomonas dyei strain 22-325]
MKKQQGFTLIELMIVVAIIAILAAIALPMYQDYVAKSQATAGLAEITPGKTQYEVLVNEGTIPTTATQIGLTASTARCGI
AVASTGITCTLKGNAAKIQGKTISLNRDSTLGTWSCVTGNSLDPKYKPAGCS
MKKQQGFTLIELMIVVAIIAILAAIALPMYQDYVAKSQATAGLAEITPGKTQYEVLVNEGTIPTTATQIGLTASTARCGI
AVASTGITCTLKGNAAKIQGKTISLNRDSTLGTWSCVTGNSLDPKYKPAGCS
Nucleotide
Download Length: 399 bp
>NTDB_id=725904 NYR99_RS17115 WP_316687920.1 3923172..3923570(-) (pilA/pilAI) [Xanthomonas dyei strain 22-325]
ATGAAGAAGCAGCAAGGCTTTACGCTGATCGAACTGATGATCGTGGTCGCGATCATCGCCATCCTGGCCGCCATCGCGCT
GCCGATGTATCAGGACTATGTTGCCAAGTCGCAGGCGACTGCGGGTCTGGCAGAAATCACTCCTGGCAAGACACAGTACG
AAGTTCTCGTCAACGAGGGCACGATTCCAACCACTGCAACGCAGATTGGCTTGACGGCGAGCACTGCGCGCTGTGGTATA
GCCGTTGCTAGCACCGGCATTACCTGCACATTGAAGGGTAATGCAGCCAAGATCCAGGGCAAGACGATTAGCCTCAATCG
CGACTCCACGCTTGGCACTTGGTCGTGCGTGACTGGTAATTCCTTGGATCCCAAGTACAAGCCGGCTGGTTGCAGCTGA
ATGAAGAAGCAGCAAGGCTTTACGCTGATCGAACTGATGATCGTGGTCGCGATCATCGCCATCCTGGCCGCCATCGCGCT
GCCGATGTATCAGGACTATGTTGCCAAGTCGCAGGCGACTGCGGGTCTGGCAGAAATCACTCCTGGCAAGACACAGTACG
AAGTTCTCGTCAACGAGGGCACGATTCCAACCACTGCAACGCAGATTGGCTTGACGGCGAGCACTGCGCGCTGTGGTATA
GCCGTTGCTAGCACCGGCATTACCTGCACATTGAAGGGTAATGCAGCCAAGATCCAGGGCAAGACGATTAGCCTCAATCG
CGACTCCACGCTTGGCACTTGGTCGTGCGTGACTGGTAATTCCTTGGATCCCAAGTACAAGCCGGCTGGTTGCAGCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilA/pilAI | Pseudomonas stutzeri DSM 10701 |
57.664 |
100 |
0.598 |
| pilA | Acinetobacter baumannii strain A118 |
51.064 |
100 |
0.545 |
| pilA/pilAII | Pseudomonas stutzeri DSM 10701 |
48.889 |
100 |
0.5 |
| pilA | Pseudomonas aeruginosa PAK |
41.06 |
100 |
0.47 |
| pilA | Vibrio cholerae O1 biovar El Tor strain E7946 |
40.278 |
100 |
0.439 |
| pilA | Vibrio cholerae C6706 |
40.278 |
100 |
0.439 |
| pilA | Vibrio cholerae strain A1552 |
40.278 |
100 |
0.439 |
| comP | Acinetobacter baylyi ADP1 |
38.776 |
100 |
0.432 |
| pilA2 | Legionella pneumophila strain ERS1305867 |
41.606 |
100 |
0.432 |
| pilA2 | Legionella pneumophila str. Paris |
40.146 |
100 |
0.417 |
| pilA | Vibrio parahaemolyticus RIMD 2210633 |
43.307 |
96.212 |
0.417 |
| pilE | Neisseria gonorrhoeae strain FA1090 |
34.641 |
100 |
0.402 |
| pilA/pilA1 | Eikenella corrodens VA1 |
35.57 |
100 |
0.402 |
| pilE | Neisseria gonorrhoeae MS11 |
32.468 |
100 |
0.379 |