Detailed information
Bioinformatically predicted
Overview
| Name | pilA/pilAI | Type | Machinery gene |
| Locus tag | NYR95_RS17100 | Genome accession | NZ_CP103837 |
| Coordinates | 3923571..3923969 (-) | Length | 132 a.a. |
| NCBI ID | WP_316687920.1 | Uniprot ID | - |
| Organism | Xanthomonas dyei strain 22-321 | ||
| Function | assembly of type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 3915342..3952203 | 3923571..3923969 | within | 0 |
Gene organization within MGE regions
Location: 3915342..3952203
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYR95_RS17060 (NYR95_17045) | - | 3915342..3916193 (+) | 852 | WP_316687912.1 | glycosyltransferase family 2 protein | - |
| NYR95_RS17065 (NYR95_17050) | - | 3916245..3917105 (+) | 861 | WP_316687913.1 | glycosyltransferase family 2 protein | - |
| NYR95_RS17070 (NYR95_17055) | - | 3917090..3918265 (+) | 1176 | WP_316687914.1 | glycosyltransferase | - |
| NYR95_RS17075 (NYR95_17060) | - | 3918259..3919101 (+) | 843 | WP_316687915.1 | glycosyltransferase | - |
| NYR95_RS17080 (NYR95_17065) | - | 3919104..3920030 (-) | 927 | WP_316687916.1 | glycosyltransferase family 9 protein | - |
| NYR95_RS17085 (NYR95_17070) | - | 3920287..3921045 (-) | 759 | WP_316687917.1 | class I SAM-dependent methyltransferase | - |
| NYR95_RS17090 (NYR95_17075) | - | 3921169..3922989 (-) | 1821 | WP_316687918.1 | hypothetical protein | - |
| NYR95_RS17095 (NYR95_17080) | - | 3923048..3923470 (-) | 423 | WP_316687919.1 | pilin | - |
| NYR95_RS17100 (NYR95_17090) | pilA/pilAI | 3923571..3923969 (-) | 399 | WP_316687920.1 | pilin | Machinery gene |
| NYR95_RS17105 (NYR95_17095) | pilC | 3924320..3925582 (+) | 1263 | WP_316687921.1 | type II secretion system F family protein | Machinery gene |
| NYR95_RS17110 (NYR95_17100) | - | 3925589..3926452 (+) | 864 | WP_115513691.1 | A24 family peptidase | - |
| NYR95_RS17115 (NYR95_17105) | coaE | 3926466..3927086 (+) | 621 | WP_316687922.1 | dephospho-CoA kinase | - |
| NYR95_RS17120 (NYR95_17110) | - | 3927240..3932021 (+) | 4782 | WP_316687923.1 | RHS repeat-associated core domain-containing protein | - |
| NYR95_RS17125 (NYR95_17115) | - | 3932658..3933061 (+) | 404 | Protein_3272 | SymE family type I addiction module toxin | - |
| NYR95_RS17130 (NYR95_17120) | - | 3933137..3933427 (+) | 291 | WP_228325572.1 | DUF1778 domain-containing protein | - |
| NYR95_RS17135 (NYR95_17125) | - | 3933424..3933915 (+) | 492 | WP_316687924.1 | GNAT family N-acetyltransferase | - |
| NYR95_RS17140 (NYR95_17130) | - | 3934060..3935394 (-) | 1335 | WP_316687925.1 | HAMP domain-containing sensor histidine kinase | - |
| NYR95_RS17145 (NYR95_17135) | - | 3935387..3936064 (-) | 678 | WP_003490678.1 | response regulator transcription factor | - |
| NYR95_RS17150 (NYR95_17140) | - | 3936083..3936667 (-) | 585 | WP_316688070.1 | hypothetical protein | - |
| NYR95_RS17155 (NYR95_17145) | rimK | 3936771..3937676 (-) | 906 | WP_167455844.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
| NYR95_RS17160 (NYR95_17150) | glgX | 3938144..3940276 (+) | 2133 | WP_316688074.1 | glycogen debranching protein GlgX | - |
| NYR95_RS17165 (NYR95_17155) | - | 3940831..3941223 (-) | 393 | WP_104617555.1 | H-NS family nucleoid-associated regulatory protein | - |
| NYR95_RS17170 (NYR95_17160) | - | 3941312..3941704 (-) | 393 | WP_316688076.1 | hypothetical protein | - |
| NYR95_RS17175 (NYR95_17165) | - | 3942247..3942792 (-) | 546 | WP_104617557.1 | hypothetical protein | - |
| NYR95_RS17180 (NYR95_17170) | - | 3942962..3943246 (+) | 285 | WP_316688080.1 | hypothetical protein | - |
| NYR95_RS17185 (NYR95_17175) | - | 3943855..3944196 (+) | 342 | WP_316688082.1 | hypothetical protein | - |
| NYR95_RS17190 (NYR95_17180) | - | 3944261..3944542 (+) | 282 | WP_228325566.1 | DUF6516 family protein | - |
| NYR95_RS17195 (NYR95_17185) | - | 3944550..3944918 (+) | 369 | WP_316688084.1 | transcriptional regulator | - |
| NYR95_RS17200 (NYR95_17190) | - | 3944992..3945627 (-) | 636 | Protein_3287 | hypothetical protein | - |
| NYR95_RS17205 (NYR95_17195) | - | 3945697..3946799 (+) | 1103 | WP_316688085.1 | IS3 family transposase | - |
| NYR95_RS17210 (NYR95_17200) | - | 3947000..3947677 (+) | 678 | WP_316688086.1 | hypothetical protein | - |
| NYR95_RS17215 (NYR95_17205) | - | 3947899..3949389 (+) | 1491 | WP_316688088.1 | hypothetical protein | - |
| NYR95_RS17220 (NYR95_17210) | - | 3949708..3950517 (-) | 810 | WP_316688091.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 132 a.a. Molecular weight: 13694.95 Da Isoelectric Point: 8.8372
>NTDB_id=725868 NYR95_RS17100 WP_316687920.1 3923571..3923969(-) (pilA/pilAI) [Xanthomonas dyei strain 22-321]
MKKQQGFTLIELMIVVAIIAILAAIALPMYQDYVAKSQATAGLAEITPGKTQYEVLVNEGTIPTTATQIGLTASTARCGI
AVASTGITCTLKGNAAKIQGKTISLNRDSTLGTWSCVTGNSLDPKYKPAGCS
MKKQQGFTLIELMIVVAIIAILAAIALPMYQDYVAKSQATAGLAEITPGKTQYEVLVNEGTIPTTATQIGLTASTARCGI
AVASTGITCTLKGNAAKIQGKTISLNRDSTLGTWSCVTGNSLDPKYKPAGCS
Nucleotide
Download Length: 399 bp
>NTDB_id=725868 NYR95_RS17100 WP_316687920.1 3923571..3923969(-) (pilA/pilAI) [Xanthomonas dyei strain 22-321]
ATGAAGAAGCAGCAAGGCTTTACGCTGATCGAACTGATGATCGTGGTCGCGATCATCGCCATCCTGGCCGCCATCGCGCT
GCCGATGTATCAGGACTATGTTGCCAAGTCGCAGGCGACTGCGGGTCTGGCAGAAATCACTCCTGGCAAGACACAGTACG
AAGTTCTCGTCAACGAGGGCACGATTCCAACCACTGCAACGCAGATTGGCTTGACGGCGAGCACTGCGCGCTGTGGTATA
GCCGTTGCTAGCACCGGCATTACCTGCACATTGAAGGGTAATGCAGCCAAGATCCAGGGCAAGACGATTAGCCTCAATCG
CGACTCCACGCTTGGCACTTGGTCGTGCGTGACTGGTAATTCCTTGGATCCCAAGTACAAGCCGGCTGGTTGCAGCTGA
ATGAAGAAGCAGCAAGGCTTTACGCTGATCGAACTGATGATCGTGGTCGCGATCATCGCCATCCTGGCCGCCATCGCGCT
GCCGATGTATCAGGACTATGTTGCCAAGTCGCAGGCGACTGCGGGTCTGGCAGAAATCACTCCTGGCAAGACACAGTACG
AAGTTCTCGTCAACGAGGGCACGATTCCAACCACTGCAACGCAGATTGGCTTGACGGCGAGCACTGCGCGCTGTGGTATA
GCCGTTGCTAGCACCGGCATTACCTGCACATTGAAGGGTAATGCAGCCAAGATCCAGGGCAAGACGATTAGCCTCAATCG
CGACTCCACGCTTGGCACTTGGTCGTGCGTGACTGGTAATTCCTTGGATCCCAAGTACAAGCCGGCTGGTTGCAGCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilA/pilAI | Pseudomonas stutzeri DSM 10701 |
57.664 |
100 |
0.598 |
| pilA | Acinetobacter baumannii strain A118 |
51.064 |
100 |
0.545 |
| pilA/pilAII | Pseudomonas stutzeri DSM 10701 |
48.889 |
100 |
0.5 |
| pilA | Pseudomonas aeruginosa PAK |
41.06 |
100 |
0.47 |
| pilA | Vibrio cholerae O1 biovar El Tor strain E7946 |
40.278 |
100 |
0.439 |
| pilA | Vibrio cholerae C6706 |
40.278 |
100 |
0.439 |
| pilA | Vibrio cholerae strain A1552 |
40.278 |
100 |
0.439 |
| comP | Acinetobacter baylyi ADP1 |
38.776 |
100 |
0.432 |
| pilA2 | Legionella pneumophila strain ERS1305867 |
41.606 |
100 |
0.432 |
| pilA2 | Legionella pneumophila str. Paris |
40.146 |
100 |
0.417 |
| pilA | Vibrio parahaemolyticus RIMD 2210633 |
43.307 |
96.212 |
0.417 |
| pilE | Neisseria gonorrhoeae strain FA1090 |
34.641 |
100 |
0.402 |
| pilA/pilA1 | Eikenella corrodens VA1 |
35.57 |
100 |
0.402 |
| pilE | Neisseria gonorrhoeae MS11 |
32.468 |
100 |
0.379 |