NTDB

Overview

Name	comP	Type	Machinery gene
Locus tag	NVV94_RS22700	Genome accession	NZ_CP102951
Coordinates	4882220..4882633 (-)	Length	137 a.a.
NCBI ID	WP_258444578.1	Uniprot ID	-
Organism	Pseudomonas sp. LS1212
Function	assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 4877220..4887633

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
NVV94_RS22670 (NVV94_22670)	-	4877485..4877934 (+)	450	WP_258444576.1	carboxypeptidase regulatory-like domain-containing protein	-
NVV94_RS22675 (NVV94_22675)	-	4878354..4878677 (+)	324	WP_258444577.1	DUF3077 domain-containing protein	-
NVV94_RS22680 (NVV94_22680)	-	4878819..4879571 (-)	753	Protein_4466	Fic family protein	-
NVV94_RS22690 (NVV94_22690)	-	4880807..4881211 (-)	405	Protein_4468	Fic family protein	-
NVV94_RS22700 (NVV94_22700)	comP	4882220..4882633 (-)	414	WP_258444578.1	pilin	Machinery gene
NVV94_RS22705 (NVV94_22705)	pilC	4883051..4884268 (+)	1218	WP_258444579.1	type II secretion system F family protein	Machinery gene
NVV94_RS22710 (NVV94_22710)	pilD	4884272..4885144 (+)	873	WP_258444580.1	A24 family peptidase	Machinery gene
NVV94_RS22715 (NVV94_22715)	coaE	4885141..4885764 (+)	624	WP_258444581.1	dephospho-CoA kinase	-
NVV94_RS22720 (NVV94_22720)	yacG	4885761..4885964 (+)	204	WP_258444582.1	DNA gyrase inhibitor YacG	-
NVV94_RS22725 (NVV94_22725)	-	4885970..4886668 (-)	699	WP_258444583.1	energy-coupling factor ABC transporter permease	-
NVV94_RS22730 (NVV94_22730)	-	4886847..4887197 (+)	351	WP_258444584.1	BON domain-containing protein	-
NVV94_RS22735 (NVV94_22735)	-	4887251..4887577 (-)	327	WP_258447791.1	VOC family protein	-

Sequence

Protein

Download Length: 137 a.a. Molecular weight: 13724.83 Da Isoelectric Point: 8.1079

                                >NTDB_id=720180 NVV94_RS22700 WP_258444578.1 4882220..4882633(-) (comP) [Pseudomonas sp. LS1212]

MKGQKGFTLIELMIVVAIIGILATIAIPAYSKYQARAKVAAGLAEITALKTPFEDSLNQGTDVASTAGIGGQGTTGNCTI

VATGTAATGAGSIVCTITNAPAPVLGKIITLTRSQTSGWACTTTVEADYAPKGCTST

Nucleotide

Download Length: 414 bp

                                >NTDB_id=720180 NVV94_RS22700 WP_258444578.1 4882220..4882633(-) (comP) [Pseudomonas sp. LS1212]

ATGAAAGGCCAGAAAGGTTTTACCCTTATCGAATTGATGATCGTGGTGGCGATCATCGGCATTCTGGCGACCATCGCCAT

TCCTGCCTATTCCAAGTACCAGGCTCGCGCCAAAGTGGCGGCGGGGCTCGCGGAAATCACGGCGCTGAAAACCCCGTTCG

AAGACAGCCTGAACCAAGGCACCGACGTAGCCAGCACCGCCGGCATCGGTGGCCAGGGCACCACCGGTAATTGCACCATC

GTAGCCACCGGAACCGCCGCGACAGGTGCCGGGAGCATCGTCTGTACCATCACCAACGCACCGGCGCCCGTACTGGGCAA

AATCATCACCCTGACGCGCTCGCAAACCAGCGGCTGGGCCTGCACCACCACCGTCGAAGCCGACTACGCGCCCAAGGGCT

GCACCAGCACCTAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(1-26)

Pilin (bacterial filament) (Pilin)

(35-135)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comP	Acinetobacter baylyi ADP1	47.619	100	0.511
pilA	Pseudomonas aeruginosa PAK	44.737	100	0.496
pilA/pilAI	Pseudomonas stutzeri DSM 10701	48.175	100	0.482
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	44.755	100	0.467
pilA	Vibrio cholerae strain A1552	44.755	100	0.467
pilA	Vibrio cholerae C6706	44.755	100	0.467
pilA/pilAII	Pseudomonas stutzeri DSM 10701	45.926	98.54	0.453
pilA	Acinetobacter baumannii strain A118	44.604	100	0.453
pilA2	Legionella pneumophila strain ERS1305867	43.478	100	0.438
pilA2	Legionella pneumophila str. Paris	42.754	100	0.431
pilA	Ralstonia pseudosolanacearum GMI1000	36.709	100	0.423
pilA	Vibrio parahaemolyticus RIMD 2210633	42.963	98.54	0.423

Detailed information NTG0720180