NTDB

Overview

Name	comYC	Type	Machinery gene
Locus tag	M8286_RS00740	Genome accession	NZ_CP097577
Coordinates	121028..121309 (+)	Length	93 a.a.
NCBI ID	WP_275601168.1	Uniprot ID	-
Organism	Streptococcus suis strain 3112
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 116028..126309

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
M8286_RS00720 (M8286_00715)	-	117689..118063 (+)	375	WP_024385120.1	DUF1033 family protein	-
M8286_RS00725 (M8286_00720)	-	118091..119041 (-)	951	WP_275601166.1	S66 peptidase family protein	-
M8286_RS00730 (M8286_00725)	comYA	119127..120077 (+)	951	WP_275601167.1	competence type IV pilus ATPase ComGA	Machinery gene
M8286_RS00735 (M8286_00730)	comYB	119989..121026 (+)	1038	WP_358639410.1	competence type IV pilus assembly protein ComGB	Machinery gene
M8286_RS00740 (M8286_00735)	comYC	121028..121309 (+)	282	WP_275601168.1	competence type IV pilus major pilin ComGC	Machinery gene
M8286_RS00745 (M8286_00740)	comGD	121290..121697 (+)	408	WP_275601169.1	competence type IV pilus minor pilin ComGD	-
M8286_RS00750 (M8286_00745)	comYE	121669..121962 (+)	294	WP_275601170.1	competence type IV pilus minor pilin ComGE	Machinery gene
M8286_RS00755 (M8286_00750)	comGF/cglF	121949..122383 (+)	435	WP_275601171.1	competence type IV pilus minor pilin ComGF	Machinery gene
M8286_RS00760 (M8286_00755)	comGG	122361..122879 (+)	519	WP_275601172.1	competence type IV pilus minor pilin ComGG	-
M8286_RS00765 (M8286_00760)	comYH	122929..123882 (+)	954	WP_275601173.1	class I SAM-dependent methyltransferase	Machinery gene
M8286_RS00770 (M8286_00765)	-	123932..125119 (+)	1188	WP_167787180.1	acetate kinase	-
M8286_RS00775 (M8286_00770)	-	125434..125985 (+)	552	WP_275601174.1	folate family ECF transporter S component	-

Sequence

Protein

Download Length: 93 a.a. Molecular weight: 10494.39 Da Isoelectric Point: 5.8717

                                >NTDB_id=690314 M8286_RS00740 WP_275601168.1 121028..121309(+) (comYC) [Streptococcus suis strain 3112]

MKKLVEMKVRGFTLVEMLVVLGIISLLLLLFVPNLSKQKDAIQKKGDAAVVKVVESQMELYELEHDKEATVEDLQQAGYI

TEKQAEQYATAKK

Nucleotide

Download Length: 282 bp

                                >NTDB_id=690314 M8286_RS00740 WP_275601168.1 121028..121309(+) (comYC) [Streptococcus suis strain 3112]

ATGAAAAAATTAGTTGAAATGAAGGTAAGAGGGTTCACTCTGGTGGAAATGTTAGTCGTTTTGGGGATCATTAGCCTACT

CTTGCTCCTCTTTGTGCCAAATTTGAGCAAACAAAAGGATGCTATTCAGAAGAAGGGGGATGCGGCTGTTGTCAAAGTAG

TGGAGAGCCAGATGGAGCTCTATGAATTGGAACATGATAAGGAAGCAACAGTGGAGGATTTGCAACAAGCAGGTTATATT

ACTGAAAAACAAGCGGAGCAGTATGCTACGGCGAAAAAATAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(8-30)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comYC	Streptococcus suis isolate S10	92.473	100	0.925
comGC/cglC	Streptococcus pneumoniae R6	63.636	94.624	0.602
comGC/cglC	Streptococcus pneumoniae Rx1	63.636	94.624	0.602
comGC/cglC	Streptococcus pneumoniae D39	63.636	94.624	0.602
comYC	Streptococcus gordonii str. Challis substr. CH1	61.798	95.699	0.591
comGC/cglC	Streptococcus mitis SK321	64.706	91.398	0.591
comGC/cglC	Streptococcus mitis NCTC 12261	64.706	91.398	0.591
comYC	Streptococcus mutans UA140	61.364	94.624	0.581
comYC	Streptococcus mutans UA159	61.364	94.624	0.581
comGC/cglC	Streptococcus pneumoniae TIGR4	66.667	87.097	0.581
comGC	Lactococcus lactis subsp. cremoris KW2	57.955	94.624	0.548
comGC	Staphylococcus aureus MW2	51.282	83.871	0.43
comGC	Staphylococcus aureus N315	51.282	83.871	0.43
comGC	Bacillus subtilis subsp. subtilis str. 168	48	80.645	0.387

Detailed information NTG0690314