Detailed information NTG0668076

Bioinformatically predicted

Overview

• Name: comGC/cglC
• Type: Machinery gene
• Locus tag: MP387_RS00835
• Genome accession: NZ_CP094226
• Coordinates: 165389..165712 (+)
• Length: 107 a.a.
• NCBI ID: WP_000735798.1
• Uniprot ID: A0A1X1HB54
• Organism: Streptococcus oralis strain 1648
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 160389..170712

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
MP387_RS00815 (MP387_00815)	nagA	161749..162900 (+)	1152	WP_001134442.1	N-acetylglucosamine-6-phosphate deacetylase	-
MP387_RS00820 (MP387_00820)	-	163053..163418 (+)	366	WP_000286396.1	DUF1033 family protein	-
MP387_RS00825 (MP387_00825)	comGA/cglA/cilD	163482..164423 (+)	942	WP_242746934.1	competence type IV pilus ATPase ComGA	Machinery gene
MP387_RS00830 (MP387_00830)	comGB/cglB	164371..165387 (+)	1017	WP_242748017.1	competence type IV pilus assembly protein ComGB	Machinery gene
MP387_RS00835 (MP387_00835)	comGC/cglC	165389..165712 (+)	324	WP_000735798.1	competence type IV pilus major pilin ComGC	Machinery gene
MP387_RS00840 (MP387_00840)	comGD/cglD	165675..166109 (+)	435	WP_242746960.1	competence type IV pilus minor pilin ComGD	Machinery gene
MP387_RS00845 (MP387_00845)	comGE/cglE	166072..166374 (+)	303	WP_242746963.1	competence type IV pilus minor pilin ComGE	Machinery gene
MP387_RS00850 (MP387_00850)	comGF/cglF	166337..166798 (+)	462	WP_242746966.1	competence type IV pilus minor pilin ComGF	Machinery gene
MP387_RS00855 (MP387_00855)	comGG/cglG	166776..167189 (+)	414	WP_242746969.1	competence type IV pilus minor pilin ComGG	Machinery gene
MP387_RS00860 (MP387_00860)	-	167222..167812 (+)	591	WP_242746972.1	class I SAM-dependent methyltransferase	-
MP387_RS00865 (MP387_00865)	comYH	167871..168824 (+)	954	WP_242746975.1	class I SAM-dependent methyltransferase	Machinery gene
MP387_RS00870 (MP387_00870)	-	168875..170065 (+)	1191	WP_242746978.1	acetate kinase	-
MP387_RS00875 (MP387_00875)	rnpA	170215..170586 (+)	372	WP_000748120.1	ribonuclease P protein component	-

Sequence

Protein

• Length: 107 a.a.
• Molecular weight: 11891.03 Da
• Isoelectric Point: 10.1883

>NTDB_id=668076 MP387_RS00835 WP_000735798.1 165389..165712(+) (comGC/cglC) [Streptococcus oralis strain 1648]
MKKLMTNLKKAKVKAFTLVEMLVVLLIISVLLLLFVPNLTKQKDAVDDKGKAAVVKVVESQAELYRLDKNDDASLSKLQA
DGRITAEQAKAYKDYHAKQKTSQTVAD

Nucleotide

• Length: 324 bp

>NTDB_id=668076 MP387_RS00835 WP_000735798.1 165389..165712(+) (comGC/cglC) [Streptococcus oralis strain 1648]
ATGAAAAAACTCATGACCAATTTAAAAAAAGCCAAGGTTAAAGCTTTCACTTTGGTAGAAATGTTAGTGGTTTTGCTTAT
CATCAGTGTTCTTCTCTTGCTCTTTGTGCCCAATTTGACCAAGCAAAAGGATGCCGTAGATGACAAAGGAAAAGCTGCTG
TTGTCAAGGTCGTGGAAAGCCAGGCAGAACTTTATCGTTTGGATAAAAATGATGATGCCAGCCTCAGCAAATTACAAGCG
GACGGCCGTATCACAGCTGAGCAAGCTAAAGCTTATAAAGACTACCATGCAAAACAAAAAACAAGTCAAACTGTTGCAGA
TTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (11-34)

3D structure

• AlphaFold DB: A0A1X1HB54

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC/cglC	Streptococcus mitis NCTC 12261	91.589	100	0.916
comGC/cglC	Streptococcus mitis SK321	88.889	92.523	0.822
comGC/cglC	Streptococcus pneumoniae R6	86.869	92.523	0.804
comGC/cglC	Streptococcus pneumoniae Rx1	86.869	92.523	0.804
comGC/cglC	Streptococcus pneumoniae D39	86.869	92.523	0.804
comGC/cglC	Streptococcus pneumoniae TIGR4	85.859	92.523	0.794
comYC	Streptococcus gordonii str. Challis substr. CH1	67.619	98.131	0.664
comYC	Streptococcus mutans UA140	70.103	90.654	0.636
comYC	Streptococcus mutans UA159	70.103	90.654	0.636
comGC	Lactococcus lactis subsp. cremoris KW2	57.426	94.393	0.542
comYC	Streptococcus suis isolate S10	65.909	82.243	0.542