Detailed information NTG0668078

Bioinformatically predicted

Overview

• Name: comGE/cglE
• Type: Machinery gene
• Locus tag: MP387_RS00845
• Genome accession: NZ_CP094226
• Coordinates: 166072..166374 (+)
• Length: 100 a.a.
• NCBI ID: WP_242746963.1
• Uniprot ID: -
• Organism: Streptococcus oralis strain 1648
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 161072..171374

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
MP387_RS00815 (MP387_00815)	nagA	161749..162900 (+)	1152	WP_001134442.1	N-acetylglucosamine-6-phosphate deacetylase	-
MP387_RS00820 (MP387_00820)	-	163053..163418 (+)	366	WP_000286396.1	DUF1033 family protein	-
MP387_RS00825 (MP387_00825)	comGA/cglA/cilD	163482..164423 (+)	942	WP_242746934.1	competence type IV pilus ATPase ComGA	Machinery gene
MP387_RS00830 (MP387_00830)	comGB/cglB	164371..165387 (+)	1017	WP_242748017.1	competence type IV pilus assembly protein ComGB	Machinery gene
MP387_RS00835 (MP387_00835)	comGC/cglC	165389..165712 (+)	324	WP_000735798.1	competence type IV pilus major pilin ComGC	Machinery gene
MP387_RS00840 (MP387_00840)	comGD/cglD	165675..166109 (+)	435	WP_242746960.1	competence type IV pilus minor pilin ComGD	Machinery gene
MP387_RS00845 (MP387_00845)	comGE/cglE	166072..166374 (+)	303	WP_242746963.1	competence type IV pilus minor pilin ComGE	Machinery gene
MP387_RS00850 (MP387_00850)	comGF/cglF	166337..166798 (+)	462	WP_242746966.1	competence type IV pilus minor pilin ComGF	Machinery gene
MP387_RS00855 (MP387_00855)	comGG/cglG	166776..167189 (+)	414	WP_242746969.1	competence type IV pilus minor pilin ComGG	Machinery gene
MP387_RS00860 (MP387_00860)	-	167222..167812 (+)	591	WP_242746972.1	class I SAM-dependent methyltransferase	-
MP387_RS00865 (MP387_00865)	comYH	167871..168824 (+)	954	WP_242746975.1	class I SAM-dependent methyltransferase	Machinery gene
MP387_RS00870 (MP387_00870)	-	168875..170065 (+)	1191	WP_242746978.1	acetate kinase	-
MP387_RS00875 (MP387_00875)	rnpA	170215..170586 (+)	372	WP_000748120.1	ribonuclease P protein component	-

Sequence

Protein

• Length: 100 a.a.
• Molecular weight: 11157.09 Da
• Isoelectric Point: 7.0157

>NTDB_id=668078 MP387_RS00845 WP_242746963.1 166072..166374(+) (comGE/cglE) [Streptococcus oralis strain 1648]
MEKLNALRKQKIKAVILMEAVVALAVFASIATLLLGQIQKNRQEEAEILQKEEVLRVAKMALQTGQNQVNINGVEVQVFA
SEKGLEVYHGSEKLLDLKEQ

Nucleotide

• Length: 303 bp

>NTDB_id=668078 MP387_RS00845 WP_242746963.1 166072..166374(+) (comGE/cglE) [Streptococcus oralis strain 1648]
ATGGAAAAATTAAACGCATTAAGGAAACAAAAAATTAAGGCAGTGATTTTAATGGAAGCGGTAGTAGCTTTGGCTGTGTT
TGCCAGCATTGCGACCCTTCTTTTGGGACAAATCCAGAAAAATAGACAAGAAGAGGCAGAAATCTTGCAAAAGGAAGAAG
TCTTGCGTGTGGCGAAGATGGCTCTGCAGACAGGTCAAAATCAGGTAAACATAAACGGAGTGGAGGTTCAGGTGTTTGCT
AGTGAAAAGGGATTGGAGGTCTACCATGGTTCAGAGAAGTTGCTCGACCTTAAAGAGCAGTAA

Domains

Predicted by InterproScan.

• Type II secretory pathway pseudopilin (ComGE) (16-96)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGE/cglE	Streptococcus mitis NCTC 12261	89.899	99	0.89
comGE/cglE	Streptococcus pneumoniae Rx1	89.899	99	0.89
comGE/cglE	Streptococcus pneumoniae D39	89.899	99	0.89
comGE/cglE	Streptococcus pneumoniae R6	89.899	99	0.89
comGE/cglE	Streptococcus pneumoniae TIGR4	89.899	99	0.89
comGE/cglE	Streptococcus mitis SK321	88.889	99	0.88
comYE	Streptococcus mutans UA140	43.478	92	0.4
comYE	Streptococcus mutans UA159	43.478	92	0.4