NTDB

Overview

Name	comYC	Type	Machinery gene
Locus tag	LOD78_RS09175	Genome accession	NZ_CP090522
Coordinates	1812832..1813149 (-)	Length	105 a.a.
NCBI ID	WP_274505424.1	Uniprot ID	-
Organism	Streptococcus parasuis strain SS17
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1807832..1818149

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LOD78_RS09140 (LOD78_09125)	-	1808264..1808815 (-)	552	WP_216806342.1	folate family ECF transporter S component	-
LOD78_RS09145 (LOD78_09130)	-	1809070..1810257 (-)	1188	WP_239604301.1	acetate kinase	-
LOD78_RS09150 (LOD78_09135)	comYH	1810307..1811260 (-)	954	WP_274505423.1	class I SAM-dependent methyltransferase	Machinery gene
LOD78_RS09155 (LOD78_09140)	comGG	1811280..1811780 (-)	501	WP_171989710.1	competence type IV pilus minor pilin ComGG	-
LOD78_RS09160 (LOD78_09145)	comYF	1811758..1812192 (-)	435	WP_216806339.1	competence type IV pilus minor pilin ComGF	Machinery gene
LOD78_RS09165 (LOD78_09150)	comGE	1812179..1812472 (-)	294	WP_105126461.1	competence type IV pilus minor pilin ComGE	-
LOD78_RS09170 (LOD78_09155)	comGD	1812444..1812848 (-)	405	WP_171989707.1	competence type IV pilus minor pilin ComGD	-
LOD78_RS09175 (LOD78_09160)	comYC	1812832..1813149 (-)	318	WP_274505424.1	competence type IV pilus major pilin ComGC	Machinery gene
LOD78_RS09180 (LOD78_09165)	comYB	1813151..1814188 (-)	1038	WP_216806336.1	competence type IV pilus assembly protein ComGB	Machinery gene
LOD78_RS09185 (LOD78_09170)	comYA	1814100..1815050 (-)	951	WP_171989704.1	competence type IV pilus ATPase ComGA	Machinery gene
LOD78_RS09190 (LOD78_09175)	-	1815138..1816088 (+)	951	WP_274505425.1	S66 peptidase family protein	-
LOD78_RS09195 (LOD78_09180)	-	1816121..1816489 (-)	369	WP_171989702.1	DUF1033 family protein	-

Sequence

Protein

Download Length: 105 a.a. Molecular weight: 12088.16 Da Isoelectric Point: 4.9669

                                >NTDB_id=643200 LOD78_RS09175 WP_274505424.1 1812832..1813149(-) (comYC) [Streptococcus parasuis strain SS17]

MKKMLKKKVKGFTLIEMLIVLGIISILLLLFVPNLSEQKQKIQEDGNAAVVKVVESQMDIYELDHGVRPTAEELEKSEMI

TEDQLEKYNNVPKEQLKEYNNAPKE

Nucleotide

Download Length: 318 bp

                                >NTDB_id=643200 LOD78_RS09175 WP_274505424.1 1812832..1813149(-) (comYC) [Streptococcus parasuis strain SS17]

ATGAAAAAAATGTTGAAAAAGAAAGTCAAAGGATTCACTTTGATTGAAATGTTAATTGTGCTTGGAATTATTAGTATTCT

CTTGCTATTATTTGTGCCAAATCTCAGTGAGCAGAAGCAAAAAATACAAGAAGACGGCAATGCGGCGGTTGTAAAAGTTG

TTGAAAGTCAAATGGACATTTACGAATTGGACCATGGTGTTCGTCCAACAGCGGAAGAATTAGAAAAATCGGAGATGATA

ACTGAAGATCAACTAGAAAAATATAATAATGTACCTAAAGAACAACTCAAAGAGTACAATAATGCACCTAAAGAATAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(6-30)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comYC	Streptococcus suis isolate S10	61.29	88.571	0.543
comGC	Lactococcus lactis subsp. cremoris KW2	53.465	96.19	0.514
comGC/cglC	Streptococcus pneumoniae TIGR4	49.524	100	0.495
comGC/cglC	Streptococcus mitis SK321	54.839	88.571	0.486
comGC/cglC	Streptococcus mitis NCTC 12261	54.348	87.619	0.476
comYC	Streptococcus mutans UA159	54.444	85.714	0.467
comYC	Streptococcus mutans UA140	54.444	85.714	0.467
comGC/cglC	Streptococcus pneumoniae D39	52.174	87.619	0.457
comGC/cglC	Streptococcus pneumoniae R6	52.174	87.619	0.457
comGC/cglC	Streptococcus pneumoniae Rx1	52.174	87.619	0.457
comYC	Streptococcus gordonii str. Challis substr. CH1	52.809	84.762	0.448
comGC	Staphylococcus aureus MW2	48.101	75.238	0.362
comGC	Staphylococcus aureus N315	48.101	75.238	0.362

Detailed information NTG0643200