NTDB

Overview

Name	pilE	Type	Machinery gene
Locus tag	LRR79_RS07960	Genome accession	NZ_CP088953
Coordinates	1933607..1934020 (+)	Length	137 a.a.
NCBI ID	WP_231759822.1	Uniprot ID	-
Organism	Microbulbifer elongatus strain DSM 6810
Function	assembly of type IV pilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	1934081..1945925	1933607..1934020	flank	61

Gene organization within MGE regions

Location: 1933607..1945925

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LRR79_RS07960	pilE	1933607..1934020 (+)	414	WP_231759822.1	pilin	Machinery gene
LRR79_RS07965	-	1934081..1936057 (+)	1977	WP_231759823.1	sulfatase-like hydrolase/transferase	-
LRR79_RS07970	-	1936054..1937163 (+)	1110	WP_231759824.1	hypothetical protein	-
LRR79_RS07975	-	1937214..1937573 (+)	360	WP_231759825.1	hypothetical protein	-
LRR79_RS07980	-	1937628..1938836 (+)	1209	WP_231759826.1	glycosyltransferase family 2 protein	-
LRR79_RS07985	-	1938881..1939717 (+)	837	WP_231759827.1	glycosyltransferase family 2 protein	-
LRR79_RS07990	-	1939849..1941045 (+)	1197	WP_231759828.1	lipopolysaccharide biosynthesis protein	-
LRR79_RS07995	-	1941067..1942092 (+)	1026	WP_231759829.1	Stealth CR1 domain-containing protein	-
LRR79_RS17375	tnpA	1942625..1942849 (+)	225	WP_407665243.1	IS66 family insertion sequence element accessory protein TnpA	-
LRR79_RS08000	tnpB	1942882..1943061 (+)	180	WP_269455115.1	IS66 family insertion sequence element accessory protein TnpB	-
LRR79_RS08005	-	1943154..1944092 (+)	939	WP_231760000.1	helix-turn-helix domain-containing protein	-
LRR79_RS08010	-	1944208..1944639 (+)	432	WP_231759831.1	nucleotidyltransferase substrate binding protein	-
LRR79_RS08015	-	1944623..1944952 (+)	330	WP_231759832.1	nucleotidyltransferase domain-containing protein	-
LRR79_RS08020	hepT	1945099..1945518 (-)	420	WP_231759833.1	type VII toxin-antitoxin system HepT family RNase toxin	-
LRR79_RS08025	mntA	1945518..1945925 (-)	408	WP_231759834.1	type VII toxin-antitoxin system MntA family adenylyltransferase antitoxin	-

Sequence

Protein

Download Length: 137 a.a. Molecular weight: 14366.44 Da Isoelectric Point: 6.9461

                                >NTDB_id=634135 LRR79_RS07960 WP_231759822.1 1933607..1934020(+) (pilE) [Microbulbifer elongatus strain DSM 6810]

MKKQQGFTLIELMIVVAIIGILAAVALPAYQDYTKRSHVTEGLALASGAKAAVQEYFSSEGVWPANNSAAGLASKTLIAG

TSVKSVEVLNSQITVTFNAKVTDDATLILTGSDTGGSISWVCNDGSLDPKYLPSRCR

Nucleotide

Download Length: 414 bp

                                >NTDB_id=634135 LRR79_RS07960 WP_231759822.1 1933607..1934020(+) (pilE) [Microbulbifer elongatus strain DSM 6810]

ATGAAAAAGCAACAGGGCTTTACTCTTATTGAATTGATGATCGTGGTTGCGATCATTGGTATTCTGGCCGCGGTAGCACT

GCCGGCGTACCAGGACTACACCAAGCGCTCGCACGTGACGGAGGGGCTAGCTCTCGCTTCTGGTGCTAAAGCTGCGGTGC

AGGAATATTTTTCCTCAGAGGGAGTGTGGCCAGCAAATAACAGTGCCGCAGGTCTGGCTTCCAAGACTCTTATCGCTGGT

ACTTCCGTAAAATCTGTGGAAGTGTTGAATAGTCAGATCACTGTTACTTTCAATGCGAAAGTTACTGATGACGCAACTCT

GATTCTGACCGGAAGTGATACAGGCGGCTCAATTTCTTGGGTATGTAACGACGGTTCGTTGGATCCGAAATACCTGCCTT

CGCGCTGCCGGTAA

Domains

Predicted by InterproScan.

Pilin (bacterial filament) (Pilin)

(36-137)

Prokaryotic N-terminal methylation motif (N_methyl)

(1-27)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
pilE	Neisseria gonorrhoeae MS11	49.032	100	0.555
pilE	Neisseria gonorrhoeae strain FA1090	46.753	100	0.526
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	36.898	100	0.504
pilA2	Legionella pneumophila strain ERS1305867	48.905	100	0.489
pilA2	Legionella pneumophila str. Paris	48.175	100	0.482
pilA	Ralstonia pseudosolanacearum GMI1000	38.75	100	0.453
pilA/pilA1	Eikenella corrodens VA1	38.816	100	0.431
comP	Acinetobacter baylyi ADP1	40.136	100	0.431
pilA/pilAII	Pseudomonas stutzeri DSM 10701	40.58	100	0.409
pilA	Acinetobacter baumannii strain A118	38.889	100	0.409
pilA	Vibrio cholerae C6706	36.735	100	0.394
pilA	Vibrio cholerae strain A1552	36.735	100	0.394
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	36.735	100	0.394
pilA/pilAI	Pseudomonas stutzeri DSM 10701	39.13	100	0.394

Detailed information NTG0634135