Detailed information
Overview
| Name | pilA/pilAI | Type | Machinery gene |
| Locus tag | LQE85_RS15485 | Genome accession | NZ_CP088000 |
| Coordinates | 3363812..3364219 (-) | Length | 135 a.a. |
| NCBI ID | WP_068853815.1 | Uniprot ID | A0AAP5AGY7 |
| Organism | Stenotrophomonas rhizophila strain Bl2-2 | ||
| Function | assembly of type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 3335551..3373259 | 3363812..3364219 | within | 0 |
Gene organization within MGE regions
Location: 3335551..3373259
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQE85_RS15350 (LQE85_15350) | - | 3335551..3336474 (-) | 924 | WP_249832990.1 | hypothetical protein | - |
| LQE85_RS15355 (LQE85_15355) | - | 3336583..3338217 (-) | 1635 | WP_249832991.1 | NAD+ synthase | - |
| LQE85_RS15360 (LQE85_15360) | sucD | 3338355..3339230 (-) | 876 | WP_093533719.1 | succinate--CoA ligase subunit alpha | - |
| LQE85_RS15365 (LQE85_15365) | sucC | 3339252..3340421 (-) | 1170 | WP_068853794.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| LQE85_RS15370 (LQE85_15370) | - | 3340665..3342278 (+) | 1614 | WP_184126716.1 | HAMP domain-containing sensor histidine kinase | - |
| LQE85_RS15375 (LQE85_15375) | pilR | 3342343..3343728 (+) | 1386 | WP_249832992.1 | sigma-54 dependent transcriptional regulator | Regulator |
| LQE85_RS15380 (LQE85_15380) | - | 3344218..3344766 (+) | 549 | WP_249832993.1 | SymE family type I addiction module toxin | - |
| LQE85_RS19750 | - | 3345345..3345467 (-) | 123 | WP_283938960.1 | hypothetical protein | - |
| LQE85_RS15385 (LQE85_15385) | - | 3345625..3346101 (-) | 477 | WP_249832994.1 | hypothetical protein | - |
| LQE85_RS15390 (LQE85_15390) | - | 3346489..3346971 (-) | 483 | WP_249832995.1 | hypothetical protein | - |
| LQE85_RS15395 (LQE85_15395) | - | 3347182..3347544 (-) | 363 | WP_249832996.1 | hypothetical protein | - |
| LQE85_RS15400 (LQE85_15400) | - | 3348190..3348462 (-) | 273 | WP_157771757.1 | hypothetical protein | - |
| LQE85_RS15405 (LQE85_15405) | - | 3349427..3349723 (-) | 297 | WP_249832997.1 | hypothetical protein | - |
| LQE85_RS15410 (LQE85_15410) | - | 3350320..3350676 (-) | 357 | WP_249832998.1 | hypothetical protein | - |
| LQE85_RS15415 (LQE85_15415) | - | 3350788..3350937 (-) | 150 | WP_217538604.1 | hypothetical protein | - |
| LQE85_RS15420 (LQE85_15420) | - | 3350930..3351412 (-) | 483 | WP_249832999.1 | hypothetical protein | - |
| LQE85_RS15425 (LQE85_15425) | - | 3351445..3351717 (-) | 273 | WP_249833000.1 | hypothetical protein | - |
| LQE85_RS15430 (LQE85_15430) | - | 3351981..3352355 (-) | 375 | WP_249833001.1 | DUF6869 domain-containing protein | - |
| LQE85_RS15435 (LQE85_15435) | - | 3352472..3352681 (-) | 210 | WP_210130936.1 | hypothetical protein | - |
| LQE85_RS15440 (LQE85_15440) | - | 3352817..3353518 (-) | 702 | WP_249833002.1 | hypothetical protein | - |
| LQE85_RS15445 (LQE85_15445) | - | 3354717..3355064 (-) | 348 | WP_249833003.1 | hypothetical protein | - |
| LQE85_RS15450 (LQE85_15450) | - | 3355331..3355819 (-) | 489 | WP_249833004.1 | hypothetical protein | - |
| LQE85_RS15455 (LQE85_15455) | - | 3355957..3356337 (-) | 381 | WP_249833005.1 | hypothetical protein | - |
| LQE85_RS15460 (LQE85_15460) | - | 3356667..3357197 (-) | 531 | WP_157771765.1 | hypothetical protein | - |
| LQE85_RS15465 (LQE85_15465) | - | 3357261..3357992 (-) | 732 | WP_249833006.1 | hypothetical protein | - |
| LQE85_RS15470 (LQE85_15470) | - | 3358171..3361209 (-) | 3039 | WP_249833007.1 | spermine synthase | - |
| LQE85_RS15475 (LQE85_15475) | pilB | 3361493..3363226 (-) | 1734 | WP_068853813.1 | type IV-A pilus assembly ATPase PilB | Machinery gene |
| LQE85_RS15480 (LQE85_15480) | - | 3363283..3363693 (-) | 411 | WP_249833008.1 | pilin | - |
| LQE85_RS15485 (LQE85_15485) | pilA/pilAI | 3363812..3364219 (-) | 408 | WP_068853815.1 | pilin | Machinery gene |
| LQE85_RS15490 (LQE85_15490) | pilC | 3364576..3365832 (+) | 1257 | WP_068853816.1 | type II secretion system F family protein | Machinery gene |
| LQE85_RS15495 (LQE85_15495) | pilD | 3365839..3366702 (+) | 864 | WP_068853817.1 | A24 family peptidase | Machinery gene |
| LQE85_RS15500 (LQE85_15500) | coaE | 3366710..3367318 (+) | 609 | WP_249833009.1 | dephospho-CoA kinase | - |
| LQE85_RS15505 (LQE85_15505) | - | 3367405..3368769 (-) | 1365 | WP_095363631.1 | HAMP domain-containing sensor histidine kinase | - |
| LQE85_RS15510 (LQE85_15510) | - | 3368732..3369409 (-) | 678 | WP_017356179.1 | response regulator transcription factor | - |
| LQE85_RS15515 (LQE85_15515) | - | 3369417..3369887 (-) | 471 | WP_095363630.1 | hypothetical protein | - |
| LQE85_RS15520 (LQE85_15520) | rimK | 3370120..3371025 (-) | 906 | WP_249833010.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
| LQE85_RS15525 (LQE85_15525) | - | 3371244..3372023 (+) | 780 | WP_249833011.1 | histidine phosphatase family protein | - |
| LQE85_RS15530 (LQE85_15530) | - | 3372025..3372897 (+) | 873 | WP_093533699.1 | NAD(P)H-hydrate dehydratase | - |
| LQE85_RS15535 (LQE85_15535) | - | 3372900..3373259 (-) | 360 | WP_184126692.1 | nuclear transport factor 2 family protein | - |
Sequence
Protein
Download Length: 135 a.a. Molecular weight: 14048.19 Da Isoelectric Point: 8.4781
>NTDB_id=632240 LQE85_RS15485 WP_068853815.1 3363812..3364219(-) (pilA/pilAI) [Stenotrophomonas rhizophila strain Bl2-2]
MKKQQGFTLIELMIVVAIIAILAAIAIPAYQDYVVRSQGASALAEITPAKVGFEQAVNEGKTPSTAAADAGFVGVGPSTS
YCTVTVGADNIQCVTKGGNATKFNGKKVIWTRTADTGLWACTSDLDAKYKPGKCT
MKKQQGFTLIELMIVVAIIAILAAIAIPAYQDYVVRSQGASALAEITPAKVGFEQAVNEGKTPSTAAADAGFVGVGPSTS
YCTVTVGADNIQCVTKGGNATKFNGKKVIWTRTADTGLWACTSDLDAKYKPGKCT
Nucleotide
Download Length: 408 bp
>NTDB_id=632240 LQE85_RS15485 WP_068853815.1 3363812..3364219(-) (pilA/pilAI) [Stenotrophomonas rhizophila strain Bl2-2]
ATGAAGAAGCAGCAGGGCTTTACCCTCATCGAACTGATGATCGTTGTCGCGATCATCGCCATCCTGGCCGCCATTGCCAT
CCCGGCTTACCAGGACTACGTGGTCCGCTCACAGGGCGCCTCGGCTCTGGCCGAAATCACCCCGGCCAAGGTCGGTTTCG
AGCAGGCTGTCAACGAAGGCAAGACCCCGTCGACTGCCGCCGCTGACGCTGGCTTCGTTGGCGTGGGCCCGTCCACCTCG
TACTGCACCGTGACCGTCGGCGCTGACAACATCCAGTGCGTCACCAAGGGCGGCAACGCCACCAAGTTCAACGGCAAGAA
GGTCATTTGGACCCGTACCGCCGACACCGGTCTGTGGGCTTGCACCTCGGACCTGGACGCCAAGTACAAGCCGGGCAAGT
GCACCTAA
ATGAAGAAGCAGCAGGGCTTTACCCTCATCGAACTGATGATCGTTGTCGCGATCATCGCCATCCTGGCCGCCATTGCCAT
CCCGGCTTACCAGGACTACGTGGTCCGCTCACAGGGCGCCTCGGCTCTGGCCGAAATCACCCCGGCCAAGGTCGGTTTCG
AGCAGGCTGTCAACGAAGGCAAGACCCCGTCGACTGCCGCCGCTGACGCTGGCTTCGTTGGCGTGGGCCCGTCCACCTCG
TACTGCACCGTGACCGTCGGCGCTGACAACATCCAGTGCGTCACCAAGGGCGGCAACGCCACCAAGTTCAACGGCAAGAA
GGTCATTTGGACCCGTACCGCCGACACCGGTCTGTGGGCTTGCACCTCGGACCTGGACGCCAAGTACAAGCCGGGCAAGT
GCACCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilA/pilAI | Pseudomonas stutzeri DSM 10701 |
66.667 |
100 |
0.667 |
| pilA/pilAII | Pseudomonas stutzeri DSM 10701 |
63.91 |
98.519 |
0.63 |
| pilA | Pseudomonas aeruginosa PAK |
47.059 |
100 |
0.533 |
| pilA | Acinetobacter baumannii strain A118 |
48.252 |
100 |
0.511 |
| comP | Acinetobacter baylyi ADP1 |
41.497 |
100 |
0.452 |
| pilA | Ralstonia pseudosolanacearum GMI1000 |
37.342 |
100 |
0.437 |
| pilA2 | Legionella pneumophila strain ERS1305867 |
41.606 |
100 |
0.422 |
| pilA2 | Legionella pneumophila str. Paris |
40.876 |
100 |
0.415 |
| pilA | Vibrio parahaemolyticus RIMD 2210633 |
40.741 |
100 |
0.407 |
| pilA | Vibrio cholerae strain A1552 |
38.732 |
100 |
0.407 |
| pilA | Vibrio cholerae C6706 |
38.732 |
100 |
0.407 |
| pilA | Vibrio cholerae O1 biovar El Tor strain E7946 |
38.732 |
100 |
0.407 |
| pilE | Neisseria gonorrhoeae strain FA1090 |
39.2 |
92.593 |
0.363 |