Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LA387_RS05910 | Genome accession | NZ_CP084377 |
| Coordinates | 1146517..1146933 (-) | Length | 138 a.a. |
| NCBI ID | WP_225666453.1 | Uniprot ID | - |
| Organism | Lactococcus garvieae strain Lg-Granada | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1109431..1155211 | 1146517..1146933 | within | 0 |
Gene organization within MGE regions
Location: 1109431..1155211
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LA387_RS05680 | comEC | 1109431..1111641 (-) | 2211 | WP_017370462.1 | DNA internalization-related competence protein ComEC/Rec2 | Machinery gene |
| LA387_RS05685 | - | 1111661..1112311 (-) | 651 | WP_004259187.1 | helix-hairpin-helix domain-containing protein | - |
| LA387_RS05690 | - | 1112369..1113544 (-) | 1176 | WP_004259189.1 | SLC13 family permease | - |
| LA387_RS05695 | - | 1113710..1115266 (-) | 1557 | WP_004259192.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
| LA387_RS05700 | - | 1115963..1116145 (+) | 183 | WP_225666403.1 | hypothetical protein | - |
| LA387_RS05705 | - | 1116792..1117517 (-) | 726 | WP_225666405.1 | CHAP domain-containing protein | - |
| LA387_RS05710 | - | 1117518..1117748 (-) | 231 | WP_225666407.1 | holin | - |
| LA387_RS05715 | - | 1117752..1118078 (-) | 327 | WP_225666409.1 | hypothetical protein | - |
| LA387_RS05720 | - | 1118111..1118308 (-) | 198 | WP_225666411.1 | hypothetical protein | - |
| LA387_RS05725 | - | 1118402..1121398 (-) | 2997 | WP_225666413.1 | hypothetical protein | - |
| LA387_RS05730 | - | 1121398..1122939 (-) | 1542 | WP_225666415.1 | distal tail protein Dit | - |
| LA387_RS05735 | - | 1122939..1127870 (-) | 4932 | WP_225666417.1 | phage tail tape measure protein | - |
| LA387_RS05740 | - | 1127952..1128443 (-) | 492 | WP_179107590.1 | zinc ribbon domain-containing protein | - |
| LA387_RS05745 | - | 1128672..1129088 (-) | 417 | WP_021214451.1 | phage tail assembly chaperone | - |
| LA387_RS05750 | - | 1129198..1129818 (-) | 621 | WP_225666420.1 | phage tail protein | - |
| LA387_RS05755 | - | 1129849..1130244 (-) | 396 | WP_225666421.1 | DUF806 family protein | - |
| LA387_RS05760 | - | 1130241..1130747 (-) | 507 | WP_225666422.1 | HK97 gp10 family phage protein | - |
| LA387_RS05765 | - | 1130749..1131099 (-) | 351 | WP_038603336.1 | phage head closure protein | - |
| LA387_RS05770 | - | 1131077..1131397 (-) | 321 | WP_225666424.1 | head-tail connector protein | - |
| LA387_RS05775 | - | 1131413..1132648 (-) | 1236 | WP_225666425.1 | phage major capsid protein | - |
| LA387_RS05780 | - | 1132660..1133364 (-) | 705 | WP_225667013.1 | head maturation protease, ClpP-related | - |
| LA387_RS05785 | - | 1133410..1134588 (-) | 1179 | WP_338085352.1 | phage portal protein | - |
| LA387_RS05790 | - | 1134585..1134794 (-) | 210 | WP_015966929.1 | DUF1056 family protein | - |
| LA387_RS05795 | - | 1134763..1136733 (-) | 1971 | WP_225666427.1 | terminase large subunit | - |
| LA387_RS05800 | - | 1136723..1137196 (-) | 474 | WP_021214441.1 | phage terminase small subunit P27 family | - |
| LA387_RS05805 | - | 1137324..1137842 (-) | 519 | WP_225666429.1 | HNH endonuclease | - |
| LA387_RS05815 | - | 1138792..1139214 (-) | 423 | WP_225666431.1 | RinA family protein | - |
| LA387_RS05820 | - | 1139292..1139585 (-) | 294 | WP_225666433.1 | DUF1359 domain-containing protein | - |
| LA387_RS05825 | - | 1139636..1139851 (-) | 216 | WP_216527913.1 | hypothetical protein | - |
| LA387_RS05830 | - | 1139848..1140036 (-) | 189 | WP_225666434.1 | hypothetical protein | - |
| LA387_RS05835 | - | 1140033..1140539 (-) | 507 | WP_225666435.1 | DUF1642 domain-containing protein | - |
| LA387_RS05840 | - | 1140837..1141193 (-) | 357 | WP_225666436.1 | DUF1064 domain-containing protein | - |
| LA387_RS05845 | - | 1141195..1141644 (-) | 450 | WP_225666437.1 | hypothetical protein | - |
| LA387_RS05850 | dut | 1141649..1142068 (-) | 420 | WP_225666438.1 | dUTP diphosphatase | - |
| LA387_RS05855 | - | 1142065..1142787 (-) | 723 | WP_225666439.1 | DUF1642 domain-containing protein | - |
| LA387_RS05860 | - | 1143042..1143203 (-) | 162 | WP_225666442.1 | hypothetical protein | - |
| LA387_RS05865 | - | 1143203..1143541 (-) | 339 | WP_017370076.1 | hypothetical protein | - |
| LA387_RS05870 | - | 1143534..1143911 (-) | 378 | WP_225666444.1 | hypothetical protein | - |
| LA387_RS05875 | - | 1143920..1144153 (-) | 234 | WP_225666445.1 | DUF1031 family protein | - |
| LA387_RS05880 | - | 1144273..1144512 (-) | 240 | WP_225666446.1 | DUF1031 family protein | - |
| LA387_RS05885 | - | 1144499..1144903 (-) | 405 | WP_225666448.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LA387_RS05890 | - | 1144900..1145049 (-) | 150 | WP_225666449.1 | hypothetical protein | - |
| LA387_RS05895 | - | 1145063..1145347 (-) | 285 | WP_225666450.1 | hypothetical protein | - |
| LA387_RS05900 | - | 1145331..1146182 (-) | 852 | WP_225666452.1 | phage replisome organizer N-terminal domain-containing protein | - |
| LA387_RS05905 | - | 1146182..1146412 (-) | 231 | WP_040086475.1 | helix-turn-helix domain-containing protein | - |
| LA387_RS05910 | ssb | 1146517..1146933 (-) | 417 | WP_225666453.1 | single-stranded DNA-binding protein | Machinery gene |
| LA387_RS05915 | - | 1146923..1147603 (-) | 681 | WP_017370188.1 | DUF1071 domain-containing protein | - |
| LA387_RS05920 | - | 1147615..1148013 (-) | 399 | WP_225666454.1 | hypothetical protein | - |
| LA387_RS05925 | - | 1148220..1148474 (-) | 255 | WP_225666455.1 | helix-turn-helix domain-containing protein | - |
| LA387_RS05930 | - | 1148567..1148704 (+) | 138 | WP_165713080.1 | hypothetical protein | - |
| LA387_RS05935 | - | 1148682..1148828 (-) | 147 | WP_225666456.1 | hypothetical protein | - |
| LA387_RS05940 | - | 1148865..1149014 (-) | 150 | WP_225666457.1 | hypothetical protein | - |
| LA387_RS05945 | - | 1149039..1149749 (-) | 711 | WP_225666458.1 | ORF6C domain-containing protein | - |
| LA387_RS05950 | - | 1149764..1150024 (-) | 261 | WP_206916930.1 | excisionase | - |
| LA387_RS05955 | - | 1150038..1150835 (-) | 798 | WP_206916929.1 | phage antirepressor KilAC domain-containing protein | - |
| LA387_RS05960 | - | 1150847..1151095 (-) | 249 | WP_004256843.1 | helix-turn-helix domain-containing protein | - |
| LA387_RS05965 | - | 1151251..1152075 (+) | 825 | WP_225666460.1 | DUF4393 domain-containing protein | - |
| LA387_RS05970 | - | 1152490..1153344 (+) | 855 | WP_225666462.1 | S24 family peptidase | - |
| LA387_RS05975 | - | 1153387..1153950 (+) | 564 | WP_004256839.1 | DUF4428 domain-containing protein | - |
| LA387_RS05980 | - | 1154072..1155211 (+) | 1140 | WP_225666464.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 138 a.a. Molecular weight: 15523.50 Da Isoelectric Point: 7.9593
>NTDB_id=610847 LA387_RS05910 WP_225666453.1 1146517..1146933(-) (ssb) [Lactococcus garvieae strain Lg-Granada]
MINNVVLVGRIVRDPELRYTPQNTAVATFTLAVNRRFKNAKGEREADFINCVIWRQPAENLANWAKKGALVGITGSIQVR
NYDNKEGQRVYVTEVLADNFQMLESSSNKTEKGKTKSQQDKDPFAGSPMEVSDDDLPF
MINNVVLVGRIVRDPELRYTPQNTAVATFTLAVNRRFKNAKGEREADFINCVIWRQPAENLANWAKKGALVGITGSIQVR
NYDNKEGQRVYVTEVLADNFQMLESSSNKTEKGKTKSQQDKDPFAGSPMEVSDDDLPF
Nucleotide
Download Length: 417 bp
>NTDB_id=610847 LA387_RS05910 WP_225666453.1 1146517..1146933(-) (ssb) [Lactococcus garvieae strain Lg-Granada]
ATGATAAATAATGTTGTGTTGGTTGGACGTATTGTCCGCGATCCAGAATTAAGATATACGCCACAGAATACTGCAGTAGC
TACTTTCACTTTAGCAGTAAATCGCCGTTTTAAAAATGCTAAGGGTGAACGAGAAGCAGATTTTATAAACTGTGTTATCT
GGAGACAGCCTGCTGAAAACTTAGCAAATTGGGCAAAAAAAGGCGCATTAGTTGGTATTACTGGAAGCATACAAGTAAGA
AATTATGATAACAAAGAAGGTCAACGTGTTTATGTAACAGAAGTATTGGCTGATAACTTTCAAATGCTAGAAAGTAGTTC
AAATAAAACTGAGAAAGGGAAAACTAAATCTCAACAAGATAAAGATCCTTTTGCCGGTTCACCAATGGAAGTCTCAGATG
ATGATTTACCATTCTAA
ATGATAAATAATGTTGTGTTGGTTGGACGTATTGTCCGCGATCCAGAATTAAGATATACGCCACAGAATACTGCAGTAGC
TACTTTCACTTTAGCAGTAAATCGCCGTTTTAAAAATGCTAAGGGTGAACGAGAAGCAGATTTTATAAACTGTGTTATCT
GGAGACAGCCTGCTGAAAACTTAGCAAATTGGGCAAAAAAAGGCGCATTAGTTGGTATTACTGGAAGCATACAAGTAAGA
AATTATGATAACAAAGAAGGTCAACGTGTTTATGTAACAGAAGTATTGGCTGATAACTTTCAAATGCTAGAAAGTAGTTC
AAATAAAACTGAGAAAGGGAAAACTAAATCTCAACAAGATAAAGATCCTTTTGCCGGTTCACCAATGGAAGTCTCAGATG
ATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.765 |
100 |
0.638 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
50 |
100 |
0.623 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.654 |
75.362 |
0.442 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.478 |
100 |
0.435 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
42.029 |
100 |
0.42 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
41.304 |
100 |
0.413 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
41.304 |
100 |
0.413 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
41.304 |
100 |
0.413 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
41.304 |
100 |
0.413 |
| ssbB/cilA | Streptococcus mitis SK321 |
41.304 |
100 |
0.413 |
| ssbA | Streptococcus mutans UA159 |
39.855 |
100 |
0.399 |
| ssb | Neisseria gonorrhoeae MS11 |
29.07 |
100 |
0.362 |
| ssb | Neisseria meningitidis MC58 |
29.07 |
100 |
0.362 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
48.077 |
75.362 |
0.362 |