Detailed information
Bioinformatically predicted
Overview
| Name | comX/comX2 | Type | Regulator |
| Locus tag | SPN034156_RS06045 | Genome accession | NC_021006 |
| Coordinates | 1122597..1123076 (+) | Length | 159 a.a. |
| NCBI ID | WP_000588860.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae SPN034156 | ||
| Function | activate transcription of late competence genes (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1120517..1178662 | 1122597..1123076 | within | 0 |
Gene organization within MGE regions
Location: 1120517..1178662
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPN034156_RS06040 (SPN034156_10750) | ftsH | 1120517..1122475 (+) | 1959 | WP_000744554.1 | ATP-dependent zinc metalloprotease FtsH | - |
| SPN034156_RS06045 (SPN034156_10760) | comX/comX2 | 1122597..1123076 (+) | 480 | WP_000588860.1 | sigma-70 family RNA polymerase sigma factor | Regulator |
| SPN034156_RS06080 | - | 1128627..1128836 (+) | 210 | Protein_1112 | transposase | - |
| SPN034156_RS11390 (SPN034156_10770) | - | 1128871..1129668 (-) | 798 | Protein_1113 | transposase | - |
| SPN034156_RS06100 (SPN034156_10780) | comW | 1129934..1130170 (+) | 237 | WP_000939546.1 | sigma(X)-activator ComW | Regulator |
| SPN034156_RS06105 (SPN034156_10790) | - | 1130401..1131687 (+) | 1287 | WP_000205044.1 | adenylosuccinate synthase | - |
| SPN034156_RS06110 (SPN034156_10800) | - | 1131929..1133077 (-) | 1149 | WP_000876732.1 | site-specific integrase | - |
| SPN034156_RS06115 (SPN034156_10810) | - | 1133263..1134186 (-) | 924 | WP_000122591.1 | exonuclease domain-containing protein | - |
| SPN034156_RS06120 (SPN034156_10820) | - | 1134199..1134582 (-) | 384 | WP_000136459.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SPN034156_RS06125 (SPN034156_10830) | - | 1134595..1134960 (-) | 366 | WP_000492031.1 | helix-turn-helix transcriptional regulator | - |
| SPN034156_RS06130 (SPN034156_10850) | - | 1135337..1135558 (-) | 222 | WP_000041097.1 | hypothetical protein | - |
| SPN034156_RS12505 (SPN034156_10860) | - | 1135677..1135823 (+) | 147 | WP_000389576.1 | hypothetical protein | - |
| SPN034156_RS06135 (SPN034156_10870) | - | 1135835..1136038 (+) | 204 | WP_000032097.1 | helix-turn-helix transcriptional regulator | - |
| SPN034156_RS06140 | - | 1136055..1136252 (+) | 198 | WP_001057654.1 | hypothetical protein | - |
| SPN034156_RS12510 (SPN034156_10880) | - | 1136263..1136424 (+) | 162 | WP_001002946.1 | hypothetical protein | - |
| SPN034156_RS06145 (SPN034156_10890) | - | 1136419..1136844 (-) | 426 | WP_000386249.1 | hypothetical protein | - |
| SPN034156_RS06150 (SPN034156_10900) | - | 1136898..1137608 (+) | 711 | WP_001002359.1 | ORF6C domain-containing protein | - |
| SPN034156_RS06155 (SPN034156_10910) | - | 1137622..1137879 (+) | 258 | WP_000370959.1 | hypothetical protein | - |
| SPN034156_RS06160 (SPN034156_10920) | - | 1137965..1138285 (+) | 321 | WP_000462824.1 | hypothetical protein | - |
| SPN034156_RS06165 (SPN034156_10930) | - | 1138301..1138597 (+) | 297 | WP_000391805.1 | hypothetical protein | - |
| SPN034156_RS06170 (SPN034156_10940) | - | 1138590..1139396 (+) | 807 | WP_001289771.1 | phage replisome organizer N-terminal domain-containing protein | - |
| SPN034156_RS06175 (SPN034156_10960) | - | 1139536..1140305 (+) | 770 | Protein_1131 | ATP-binding protein | - |
| SPN034156_RS06180 | - | 1140320..1140514 (+) | 195 | WP_000470307.1 | hypothetical protein | - |
| SPN034156_RS06185 (SPN034156_10970) | - | 1140514..1140732 (+) | 219 | WP_000891962.1 | hypothetical protein | - |
| SPN034156_RS11400 | - | 1141114..1141212 (+) | 99 | Protein_1134 | single-stranded DNA-binding protein | - |
| SPN034156_RS12515 (SPN034156_10990) | - | 1141226..1141393 (+) | 168 | WP_000233203.1 | hypothetical protein | - |
| SPN034156_RS06205 (SPN034156_11000) | - | 1141561..1141878 (+) | 318 | WP_000969665.1 | hypothetical protein | - |
| SPN034156_RS12780 | - | 1141880..1141954 (+) | 75 | Protein_1137 | DUF1642 domain-containing protein | - |
| SPN034156_RS06210 (SPN034156_11020) | - | 1142131..1142532 (+) | 402 | WP_000736390.1 | transcriptional activator | - |
| SPN034156_RS06215 (SPN034156_11030) | - | 1142720..1143263 (+) | 544 | Protein_1139 | site-specific integrase | - |
| SPN034156_RS06220 (SPN034156_11040) | - | 1143640..1143960 (+) | 321 | WP_000282427.1 | HNH endonuclease | - |
| SPN034156_RS06225 (SPN034156_11050) | - | 1144097..1144489 (+) | 393 | WP_001118283.1 | P27 family phage terminase small subunit | - |
| SPN034156_RS06230 (SPN034156_11060) | - | 1144482..1146213 (+) | 1732 | Protein_1142 | terminase large subunit | - |
| SPN034156_RS06235 | - | 1146221..1146439 (+) | 219 | WP_001002923.1 | hypothetical protein | - |
| SPN034156_RS06240 (SPN034156_11080) | - | 1146457..1147659 (+) | 1203 | WP_000510803.1 | phage portal protein | - |
| SPN034156_RS06245 (SPN034156_11090) | - | 1147643..1148218 (+) | 576 | WP_001172115.1 | HK97 family phage prohead protease | - |
| SPN034156_RS06250 (SPN034156_11100) | - | 1148215..1149381 (+) | 1167 | WP_001030357.1 | phage major capsid protein | - |
| SPN034156_RS06255 | - | 1149393..1149662 (+) | 270 | WP_000262606.1 | hypothetical protein | - |
| SPN034156_RS06260 (SPN034156_11120) | - | 1149665..1149946 (+) | 282 | WP_000370976.1 | hypothetical protein | - |
| SPN034156_RS06265 (SPN034156_11130) | - | 1149933..1150232 (+) | 300 | WP_000267055.1 | phage head closure protein | - |
| SPN034156_RS06270 (SPN034156_11140) | - | 1150229..1150576 (+) | 348 | WP_000063886.1 | HK97 gp10 family phage protein | - |
| SPN034156_RS06275 (SPN034156_11150) | - | 1150573..1150896 (+) | 324 | WP_000777003.1 | hypothetical protein | - |
| SPN034156_RS06280 (SPN034156_11160) | - | 1150908..1151486 (+) | 579 | WP_000191279.1 | major tail protein | - |
| SPN034156_RS06285 (SPN034156_11170) | - | 1151498..1151917 (+) | 420 | WP_001227146.1 | hypothetical protein | - |
| SPN034156_RS06290 (SPN034156_11180) | - | 1152195..1155291 (+) | 3097 | Protein_1154 | phage tail tape measure protein | - |
| SPN034156_RS06295 (SPN034156_11190) | - | 1155288..1156010 (+) | 723 | WP_000589856.1 | hypothetical protein | - |
| SPN034156_RS13145 (SPN034156_11200) | - | 1156011..1161355 (+) | 5345 | Protein_1156 | phage tail spike protein | - |
| SPN034156_RS13150 (SPN034156_11210) | - | 1161352..1161468 (+) | 117 | WP_001063632.1 | hypothetical protein | - |
| SPN034156_RS06310 (SPN034156_11220) | - | 1161449..1161652 (+) | 204 | WP_001091113.1 | hypothetical protein | - |
| SPN034156_RS06315 (SPN034156_11230) | - | 1161655..1162005 (+) | 351 | WP_000852241.1 | hypothetical protein | - |
| SPN034156_RS06320 (SPN034156_11240) | - | 1162014..1162430 (+) | 417 | WP_001165344.1 | phage holin family protein | - |
| SPN034156_RS06325 (SPN034156_11250) | - | 1162434..1162766 (+) | 333 | WP_001186219.1 | phage holin | - |
| SPN034156_RS06330 (SPN034156_11260) | - | 1162770..1163726 (+) | 957 | WP_000350505.1 | N-acetylmuramoyl-L-alanine amidase family protein | - |
| SPN034156_RS06340 | - | 1163947..1164135 (-) | 189 | WP_000109850.1 | hypothetical protein | - |
| SPN034156_RS06345 (SPN034156_11290) | tadA | 1164703..1165170 (+) | 468 | WP_000291870.1 | tRNA adenosine(34) deaminase TadA | - |
| SPN034156_RS06350 (SPN034156_11300) | - | 1165356..1165799 (+) | 444 | WP_000701992.1 | dUTP diphosphatase | - |
| SPN034156_RS06355 (SPN034156_11310) | - | 1165801..1166316 (+) | 516 | WP_001838385.1 | histidine phosphatase family protein | - |
| SPN034156_RS06360 (SPN034156_11320) | radA | 1166330..1167691 (+) | 1362 | WP_074017595.1 | DNA repair protein RadA | Machinery gene |
| SPN034156_RS06365 (SPN034156_11330) | - | 1167764..1168261 (+) | 498 | WP_001809263.1 | carbonic anhydrase | - |
| SPN034156_RS06375 (SPN034156_11340) | - | 1168286..1169116 (+) | 831 | Protein_1169 | PrsW family glutamic-type intramembrane protease | - |
| SPN034156_RS06380 (SPN034156_11350) | - | 1169261..1170229 (+) | 969 | WP_000010163.1 | ribose-phosphate diphosphokinase | - |
| SPN034156_RS11415 (SPN034156_11360) | - | 1170366..1170644 (-) | 279 | Protein_1171 | transposase family protein | - |
| SPN034156_RS12800 | - | 1170688..1171613 (-) | 926 | Protein_1172 | Rpn family recombination-promoting nuclease/putative transposase | - |
| SPN034156_RS06405 (SPN034156_11390) | polA | 1171869..1174502 (+) | 2634 | WP_001841423.1 | DNA polymerase I | - |
| SPN034156_RS06410 (SPN034156_11400) | - | 1174587..1175024 (+) | 438 | WP_000076479.1 | CoA-binding protein | - |
| SPN034156_RS12805 | - | 1175065..1175538 (+) | 474 | WP_049779681.1 | hypothetical protein | - |
| SPN034156_RS06420 (SPN034156_11410) | - | 1175567..1176577 (-) | 1011 | WP_000009171.1 | YeiH family protein | - |
| SPN034156_RS06425 (SPN034156_11420) | - | 1176726..1177895 (+) | 1170 | WP_000366345.1 | pyridoxal phosphate-dependent aminotransferase | - |
| SPN034156_RS06430 (SPN034156_11430) | recO | 1177892..1178662 (+) | 771 | WP_000616162.1 | DNA repair protein RecO | - |
Sequence
Protein
Download Length: 159 a.a. Molecular weight: 19817.45 Da Isoelectric Point: 7.3795
>NTDB_id=58045 SPN034156_RS06045 WP_000588860.1 1122597..1123076(+) (comX/comX2) [Streptococcus pneumoniae SPN034156]
MIKELYEEVQGTVYKCRNEYYLHLWELSDWDQEGMLCLHELISREEGLADDIPRLRKYFKTKFRNRILDYIRKQESQKRK
YDKEPYEEVGELSHRISEGGLWLDDYYLFHETLRDYRNKQSKEKQEELERVLSNERFRGRQRVLRDLRIVFKEFTIRTH
MIKELYEEVQGTVYKCRNEYYLHLWELSDWDQEGMLCLHELISREEGLADDIPRLRKYFKTKFRNRILDYIRKQESQKRK
YDKEPYEEVGELSHRISEGGLWLDDYYLFHETLRDYRNKQSKEKQEELERVLSNERFRGRQRVLRDLRIVFKEFTIRTH
Nucleotide
Download Length: 480 bp
>NTDB_id=58045 SPN034156_RS06045 WP_000588860.1 1122597..1123076(+) (comX/comX2) [Streptococcus pneumoniae SPN034156]
ATGATTAAAGAATTGTATGAAGAAGTCCAAGGGACTGTGTATAAGTGTAGAAATGAATATTACCTTCATTTATGGGAATT
GTCGGATTGGGACCAAGAAGGCATGCTCTGCTTACATGAATTGATTAGTAGAGAAGAAGGACTGGCAGACGATATTCCAC
GTTTAAGGAAATATTTCAAAACCAAGTTTCGAAATCGAATTTTAGACTATATCCGTAAGCAGGAAAGTCAGAAGCGTAAA
TACGATAAAGAACCCTATGAAGAAGTGGGTGAGCTCAGTCATCGTATAAGTGAGGGAGGTCTCTGGCTAGATGATTATTA
TCTCTTTCATGAAACACTAAGAGATTATAGAAACAAACAAAGTAAAGAGAAACAAGAAGAACTAGAACGCGTCTTAAGCA
ATGAACGATTTCGAGGGCGTCAAAGAGTATTAAGAGACTTACGCATTGTGTTTAAGGAGTTTACTATCCGTACCCACTAG
ATGATTAAAGAATTGTATGAAGAAGTCCAAGGGACTGTGTATAAGTGTAGAAATGAATATTACCTTCATTTATGGGAATT
GTCGGATTGGGACCAAGAAGGCATGCTCTGCTTACATGAATTGATTAGTAGAGAAGAAGGACTGGCAGACGATATTCCAC
GTTTAAGGAAATATTTCAAAACCAAGTTTCGAAATCGAATTTTAGACTATATCCGTAAGCAGGAAAGTCAGAAGCGTAAA
TACGATAAAGAACCCTATGAAGAAGTGGGTGAGCTCAGTCATCGTATAAGTGAGGGAGGTCTCTGGCTAGATGATTATTA
TCTCTTTCATGAAACACTAAGAGATTATAGAAACAAACAAAGTAAAGAGAAACAAGAAGAACTAGAACGCGTCTTAAGCA
ATGAACGATTTCGAGGGCGTCAAAGAGTATTAAGAGACTTACGCATTGTGTTTAAGGAGTTTACTATCCGTACCCACTAG
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.