Detailed information    

insolico Bioinformatically predicted

Overview


Name   comW   Type   Regulator
Locus tag   SPN034156_RS06100 Genome accession   NC_021006
Coordinates   1129934..1130170 (+) Length   78 a.a.
NCBI ID   WP_000939546.1    Uniprot ID   -
Organism   Streptococcus pneumoniae SPN034156     
Function   stabilization and activation of ComX (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1120517..1178662 1129934..1130170 within 0
IS/Tn 1129411..1129617 1129934..1130170 flank 317


Gene organization within MGE regions


Location: 1120517..1178662
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SPN034156_RS06040 (SPN034156_10750) ftsH 1120517..1122475 (+) 1959 WP_000744554.1 ATP-dependent zinc metalloprotease FtsH -
  SPN034156_RS06045 (SPN034156_10760) comX/comX2 1122597..1123076 (+) 480 WP_000588860.1 sigma-70 family RNA polymerase sigma factor Regulator
  SPN034156_RS06080 - 1128627..1128836 (+) 210 Protein_1112 transposase -
  SPN034156_RS11390 (SPN034156_10770) - 1128871..1129668 (-) 798 Protein_1113 transposase -
  SPN034156_RS06100 (SPN034156_10780) comW 1129934..1130170 (+) 237 WP_000939546.1 sigma(X)-activator ComW Regulator
  SPN034156_RS06105 (SPN034156_10790) - 1130401..1131687 (+) 1287 WP_000205044.1 adenylosuccinate synthase -
  SPN034156_RS06110 (SPN034156_10800) - 1131929..1133077 (-) 1149 WP_000876732.1 site-specific integrase -
  SPN034156_RS06115 (SPN034156_10810) - 1133263..1134186 (-) 924 WP_000122591.1 exonuclease domain-containing protein -
  SPN034156_RS06120 (SPN034156_10820) - 1134199..1134582 (-) 384 WP_000136459.1 ImmA/IrrE family metallo-endopeptidase -
  SPN034156_RS06125 (SPN034156_10830) - 1134595..1134960 (-) 366 WP_000492031.1 helix-turn-helix transcriptional regulator -
  SPN034156_RS06130 (SPN034156_10850) - 1135337..1135558 (-) 222 WP_000041097.1 hypothetical protein -
  SPN034156_RS12505 (SPN034156_10860) - 1135677..1135823 (+) 147 WP_000389576.1 hypothetical protein -
  SPN034156_RS06135 (SPN034156_10870) - 1135835..1136038 (+) 204 WP_000032097.1 helix-turn-helix transcriptional regulator -
  SPN034156_RS06140 - 1136055..1136252 (+) 198 WP_001057654.1 hypothetical protein -
  SPN034156_RS12510 (SPN034156_10880) - 1136263..1136424 (+) 162 WP_001002946.1 hypothetical protein -
  SPN034156_RS06145 (SPN034156_10890) - 1136419..1136844 (-) 426 WP_000386249.1 hypothetical protein -
  SPN034156_RS06150 (SPN034156_10900) - 1136898..1137608 (+) 711 WP_001002359.1 ORF6C domain-containing protein -
  SPN034156_RS06155 (SPN034156_10910) - 1137622..1137879 (+) 258 WP_000370959.1 hypothetical protein -
  SPN034156_RS06160 (SPN034156_10920) - 1137965..1138285 (+) 321 WP_000462824.1 hypothetical protein -
  SPN034156_RS06165 (SPN034156_10930) - 1138301..1138597 (+) 297 WP_000391805.1 hypothetical protein -
  SPN034156_RS06170 (SPN034156_10940) - 1138590..1139396 (+) 807 WP_001289771.1 phage replisome organizer N-terminal domain-containing protein -
  SPN034156_RS06175 (SPN034156_10960) - 1139536..1140305 (+) 770 Protein_1131 ATP-binding protein -
  SPN034156_RS06180 - 1140320..1140514 (+) 195 WP_000470307.1 hypothetical protein -
  SPN034156_RS06185 (SPN034156_10970) - 1140514..1140732 (+) 219 WP_000891962.1 hypothetical protein -
  SPN034156_RS11400 - 1141114..1141212 (+) 99 Protein_1134 single-stranded DNA-binding protein -
  SPN034156_RS12515 (SPN034156_10990) - 1141226..1141393 (+) 168 WP_000233203.1 hypothetical protein -
  SPN034156_RS06205 (SPN034156_11000) - 1141561..1141878 (+) 318 WP_000969665.1 hypothetical protein -
  SPN034156_RS12780 - 1141880..1141954 (+) 75 Protein_1137 DUF1642 domain-containing protein -
  SPN034156_RS06210 (SPN034156_11020) - 1142131..1142532 (+) 402 WP_000736390.1 transcriptional activator -
  SPN034156_RS06215 (SPN034156_11030) - 1142720..1143263 (+) 544 Protein_1139 site-specific integrase -
  SPN034156_RS06220 (SPN034156_11040) - 1143640..1143960 (+) 321 WP_000282427.1 HNH endonuclease -
  SPN034156_RS06225 (SPN034156_11050) - 1144097..1144489 (+) 393 WP_001118283.1 P27 family phage terminase small subunit -
  SPN034156_RS06230 (SPN034156_11060) - 1144482..1146213 (+) 1732 Protein_1142 terminase large subunit -
  SPN034156_RS06235 - 1146221..1146439 (+) 219 WP_001002923.1 hypothetical protein -
  SPN034156_RS06240 (SPN034156_11080) - 1146457..1147659 (+) 1203 WP_000510803.1 phage portal protein -
  SPN034156_RS06245 (SPN034156_11090) - 1147643..1148218 (+) 576 WP_001172115.1 HK97 family phage prohead protease -
  SPN034156_RS06250 (SPN034156_11100) - 1148215..1149381 (+) 1167 WP_001030357.1 phage major capsid protein -
  SPN034156_RS06255 - 1149393..1149662 (+) 270 WP_000262606.1 hypothetical protein -
  SPN034156_RS06260 (SPN034156_11120) - 1149665..1149946 (+) 282 WP_000370976.1 hypothetical protein -
  SPN034156_RS06265 (SPN034156_11130) - 1149933..1150232 (+) 300 WP_000267055.1 phage head closure protein -
  SPN034156_RS06270 (SPN034156_11140) - 1150229..1150576 (+) 348 WP_000063886.1 HK97 gp10 family phage protein -
  SPN034156_RS06275 (SPN034156_11150) - 1150573..1150896 (+) 324 WP_000777003.1 hypothetical protein -
  SPN034156_RS06280 (SPN034156_11160) - 1150908..1151486 (+) 579 WP_000191279.1 major tail protein -
  SPN034156_RS06285 (SPN034156_11170) - 1151498..1151917 (+) 420 WP_001227146.1 hypothetical protein -
  SPN034156_RS06290 (SPN034156_11180) - 1152195..1155291 (+) 3097 Protein_1154 phage tail tape measure protein -
  SPN034156_RS06295 (SPN034156_11190) - 1155288..1156010 (+) 723 WP_000589856.1 hypothetical protein -
  SPN034156_RS13145 (SPN034156_11200) - 1156011..1161355 (+) 5345 Protein_1156 phage tail spike protein -
  SPN034156_RS13150 (SPN034156_11210) - 1161352..1161468 (+) 117 WP_001063632.1 hypothetical protein -
  SPN034156_RS06310 (SPN034156_11220) - 1161449..1161652 (+) 204 WP_001091113.1 hypothetical protein -
  SPN034156_RS06315 (SPN034156_11230) - 1161655..1162005 (+) 351 WP_000852241.1 hypothetical protein -
  SPN034156_RS06320 (SPN034156_11240) - 1162014..1162430 (+) 417 WP_001165344.1 phage holin family protein -
  SPN034156_RS06325 (SPN034156_11250) - 1162434..1162766 (+) 333 WP_001186219.1 phage holin -
  SPN034156_RS06330 (SPN034156_11260) - 1162770..1163726 (+) 957 WP_000350505.1 N-acetylmuramoyl-L-alanine amidase family protein -
  SPN034156_RS06340 - 1163947..1164135 (-) 189 WP_000109850.1 hypothetical protein -
  SPN034156_RS06345 (SPN034156_11290) tadA 1164703..1165170 (+) 468 WP_000291870.1 tRNA adenosine(34) deaminase TadA -
  SPN034156_RS06350 (SPN034156_11300) - 1165356..1165799 (+) 444 WP_000701992.1 dUTP diphosphatase -
  SPN034156_RS06355 (SPN034156_11310) - 1165801..1166316 (+) 516 WP_001838385.1 histidine phosphatase family protein -
  SPN034156_RS06360 (SPN034156_11320) radA 1166330..1167691 (+) 1362 WP_074017595.1 DNA repair protein RadA Machinery gene
  SPN034156_RS06365 (SPN034156_11330) - 1167764..1168261 (+) 498 WP_001809263.1 carbonic anhydrase -
  SPN034156_RS06375 (SPN034156_11340) - 1168286..1169116 (+) 831 Protein_1169 PrsW family glutamic-type intramembrane protease -
  SPN034156_RS06380 (SPN034156_11350) - 1169261..1170229 (+) 969 WP_000010163.1 ribose-phosphate diphosphokinase -
  SPN034156_RS11415 (SPN034156_11360) - 1170366..1170644 (-) 279 Protein_1171 transposase family protein -
  SPN034156_RS12800 - 1170688..1171613 (-) 926 Protein_1172 Rpn family recombination-promoting nuclease/putative transposase -
  SPN034156_RS06405 (SPN034156_11390) polA 1171869..1174502 (+) 2634 WP_001841423.1 DNA polymerase I -
  SPN034156_RS06410 (SPN034156_11400) - 1174587..1175024 (+) 438 WP_000076479.1 CoA-binding protein -
  SPN034156_RS12805 - 1175065..1175538 (+) 474 WP_049779681.1 hypothetical protein -
  SPN034156_RS06420 (SPN034156_11410) - 1175567..1176577 (-) 1011 WP_000009171.1 YeiH family protein -
  SPN034156_RS06425 (SPN034156_11420) - 1176726..1177895 (+) 1170 WP_000366345.1 pyridoxal phosphate-dependent aminotransferase -
  SPN034156_RS06430 (SPN034156_11430) recO 1177892..1178662 (+) 771 WP_000616162.1 DNA repair protein RecO -

Sequence


Protein


Download         Length: 78 a.a.        Molecular weight: 9686.14 Da        Isoelectric Point: 6.7051

>NTDB_id=58046 SPN034156_RS06100 WP_000939546.1 1129934..1130170(+) (comW) [Streptococcus pneumoniae SPN034156]
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCRRDFIVYHYRVAYRLYLEKLVMNRGFISC

Nucleotide


Download         Length: 237 bp        

>NTDB_id=58046 SPN034156_RS06100 WP_000939546.1 1129934..1130170(+) (comW) [Streptococcus pneumoniae SPN034156]
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCGTAGGGATTTTA
TCGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comW Streptococcus pneumoniae Rx1

98.718

100

0.987

  comW Streptococcus pneumoniae D39

98.718

100

0.987

  comW Streptococcus pneumoniae R6

98.718

100

0.987

  comW Streptococcus pneumoniae TIGR4

98.718

100

0.987

  comW Streptococcus mitis SK321

76.923

100

0.769

  comW Streptococcus mitis NCTC 12261

76.623

98.718

0.756


Multiple sequence alignment