Detailed information NTG0576099

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: KPA27_RS00725
• Genome accession: NZ_CP076517
• Coordinates: 119710..119991 (+)
• Length: 93 a.a.
• NCBI ID: WP_024395447.1
• Uniprot ID: A0A123SUT7
• Organism: Streptococcus suis strain 39565
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 114710..124991

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
KPA27_RS00705 (KPA27_00705)	-	116373..116738 (+)	366	WP_024395451.1	DUF1033 family protein	-
KPA27_RS00710 (KPA27_00710)	-	116773..117723 (-)	951	WP_014637311.1	S66 peptidase family protein	-
KPA27_RS00715 (KPA27_00715)	comYA	117809..118759 (+)	951	WP_105140681.1	competence type IV pilus ATPase ComGA	Machinery gene
KPA27_RS00720 (KPA27_00720)	comYB	118671..119708 (+)	1038	WP_238492613.1	competence type IV pilus assembly protein ComGB	Machinery gene
KPA27_RS00725 (KPA27_00725)	comYC	119710..119991 (+)	282	WP_024395447.1	competence type IV pilus major pilin ComGC	Machinery gene
KPA27_RS00730 (KPA27_00730)	comGD	119972..120379 (+)	408	WP_024395446.1	competence type IV pilus minor pilin ComGD	-
KPA27_RS00735 (KPA27_00735)	comYE	120351..120644 (+)	294	WP_002936548.1	competence type IV pilus minor pilin ComGE	Machinery gene
KPA27_RS00740 (KPA27_00740)	comGF/cglF	120631..121065 (+)	435	WP_024395445.1	competence type IV pilus minor pilin ComGF	Machinery gene
KPA27_RS00745 (KPA27_00745)	comGG	121043..121453 (+)	411	WP_024395444.1	competence type IV pilus minor pilin ComGG	-
KPA27_RS00750 (KPA27_00750)	comYH	121510..122463 (+)	954	WP_044776365.1	class I SAM-dependent methyltransferase	Machinery gene
KPA27_RS00755 (KPA27_00755)	-	122513..123700 (+)	1188	WP_014637319.1	acetate kinase	-
KPA27_RS00760 (KPA27_00760)	-	123961..124512 (+)	552	WP_014637320.1	folate family ECF transporter S component	-

Sequence

Protein

• Length: 93 a.a.
• Molecular weight: 10351.20 Da
• Isoelectric Point: 5.1316

>NTDB_id=576099 KPA27_RS00725 WP_024395447.1 119710..119991(+) (comYC) [Streptococcus suis strain 39565]
MKKLIEMKVKGFTLVEMLVVLGIISLLLLLFVPNLSQQKDAVQEKGNAAVVKVVESQMELYELEHDEEATVADLQAAGYI
TEKQAKQYATAKK

Nucleotide

• Length: 282 bp

>NTDB_id=576099 KPA27_RS00725 WP_024395447.1 119710..119991(+) (comYC) [Streptococcus suis strain 39565]
ATGAAAAAATTAATTGAAATGAAGGTAAAAGGGTTCACTCTGGTGGAAATGTTAGTCGTTTTGGGGATCATTAGCCTGCT
CTTGCTCCTTTTTGTGCCAAATTTGAGCCAGCAGAAGGATGCTGTTCAAGAGAAAGGAAATGCTGCGGTTGTCAAAGTAG
TAGAGAGCCAGATGGAGCTCTATGAATTGGAACATGACGAGGAAGCAACGGTGGCAGACTTGCAGGCAGCTGGCTACATC
ACTGAAAAACAAGCAAAACAGTATGCTACGGCGAAAAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

3D structure

• AlphaFold DB: A0A123SUT7

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus suis isolate S10	94.624	100	0.946
comGC/cglC	Streptococcus pneumoniae TIGR4	66.304	98.925	0.656
comGC/cglC	Streptococcus pneumoniae Rx1	66.304	98.925	0.656
comGC/cglC	Streptococcus pneumoniae D39	66.304	98.925	0.656
comGC/cglC	Streptococcus pneumoniae R6	66.304	98.925	0.656
comGC/cglC	Streptococcus mitis NCTC 12261	66.304	98.925	0.656
comGC/cglC	Streptococcus mitis SK321	66.304	98.925	0.656
comYC	Streptococcus gordonii str. Challis substr. CH1	65.169	95.699	0.624
comYC	Streptococcus mutans UA140	61.364	94.624	0.581
comYC	Streptococcus mutans UA159	61.364	94.624	0.581
comGC	Lactococcus lactis subsp. cremoris KW2	57.955	94.624	0.548
comGC	Staphylococcus aureus MW2	48.718	83.871	0.409
comGC	Staphylococcus aureus N315	48.718	83.871	0.409
comGC	Bacillus subtilis subsp. subtilis str. 168	46.667	80.645	0.376