Detailed information NTG0557848

Bioinformatically predicted

Overview

• Name: comGC/cglC
• Type: Machinery gene
• Locus tag: INT76_RS06220
• Genome accession: NZ_CP073084
• Coordinates: 1228576..1228890 (-)
• Length: 104 a.a.
• NCBI ID: WP_212569661.1
• Uniprot ID: -
• Organism: Streptococcus oriscaviae strain HKU75
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1223576..1233890

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
INT76_RS06185 (INT76_06185)	-	1223982..1224536 (-)	555	WP_212569656.1	folate family ECF transporter S component	-
INT76_RS06190 (INT76_06190)	-	1224840..1226027 (-)	1188	WP_212569657.1	acetate kinase	-
INT76_RS06195 (INT76_06195)	comYH	1226086..1227030 (-)	945	WP_212569658.1	class I SAM-dependent methyltransferase	Machinery gene
INT76_RS06200 (INT76_06200)	comGG	1227105..1227524 (-)	420	WP_212569659.1	competence type IV pilus minor pilin ComGG	-
INT76_RS06205 (INT76_06205)	comYF	1227502..1227936 (-)	435	WP_212573034.1	competence type IV pilus minor pilin ComGF	Machinery gene
INT76_RS06210 (INT76_06210)	comYE	1227923..1228216 (-)	294	WP_212569660.1	competence type IV pilus minor pilin ComGE	Machinery gene
INT76_RS06215 (INT76_06215)	comGD/cglD	1228188..1228616 (-)	429	WP_212573035.1	competence type IV pilus minor pilin ComGD	Machinery gene
INT76_RS06220 (INT76_06220)	comGC/cglC	1228576..1228890 (-)	315	WP_212569661.1	competence type IV pilus major pilin ComGC	Machinery gene
INT76_RS06225 (INT76_06225)	comYB	1228892..1229929 (-)	1038	WP_282960473.1	competence type IV pilus assembly protein ComGB	Machinery gene
INT76_RS06230 (INT76_06230)	comGA/cglA/cilD	1229841..1230791 (-)	951	WP_212569662.1	competence type IV pilus ATPase ComGA	Machinery gene
INT76_RS06235 (INT76_06235)	-	1230879..1231847 (+)	969	WP_212569663.1	S66 peptidase family protein	-
INT76_RS06240 (INT76_06240)	-	1231866..1232225 (-)	360	WP_212569664.1	DUF1033 family protein	-

Sequence

Protein

• Length: 104 a.a.
• Molecular weight: 11458.38 Da
• Isoelectric Point: 9.3504

>NTDB_id=557848 INT76_RS06220 WP_212569661.1 1228576..1228890(-) (comGC/cglC) [Streptococcus oriscaviae strain HKU75]
MKKLMKIKTKAFTLVEMLFTLVIISILLLLFVPNLSKQKDAVKDTGGAAVVKVVESQAELYELSHGGDATLSKLVENGAI
TAEQSQTYNEYYAKHTDKARTVNP

Nucleotide

• Length: 315 bp

>NTDB_id=557848 INT76_RS06220 WP_212569661.1 1228576..1228890(-) (comGC/cglC) [Streptococcus oriscaviae strain HKU75]
ATGAAAAAATTGATGAAGATAAAAACAAAAGCATTTACTTTAGTGGAAATGTTATTTACCTTGGTGATCATTTCCATTCT
CTTGCTACTCTTTGTGCCCAACCTGAGCAAGCAAAAGGATGCGGTCAAGGATACAGGCGGGGCAGCCGTGGTCAAGGTGG
TGGAGAGCCAGGCCGAGCTCTACGAATTAAGTCACGGCGGAGATGCGACCCTATCAAAACTGGTAGAAAATGGAGCAATC
ACAGCGGAGCAATCGCAGACCTACAATGAATATTATGCAAAACATACTGACAAGGCTCGCACGGTCAACCCGTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC/cglC	Streptococcus mitis SK321	66.355	100	0.683
comYC	Streptococcus mutans UA140	68.627	98.077	0.673
comYC	Streptococcus mutans UA159	68.627	98.077	0.673
comYC	Streptococcus gordonii str. Challis substr. CH1	64.078	99.038	0.635
comGC/cglC	Streptococcus mitis NCTC 12261	66	96.154	0.635
comGC/cglC	Streptococcus pneumoniae R6	61.682	100	0.635
comGC/cglC	Streptococcus pneumoniae D39	61.682	100	0.635
comGC/cglC	Streptococcus pneumoniae Rx1	61.682	100	0.635
comGC/cglC	Streptococcus pneumoniae TIGR4	61.682	100	0.635
comGC	Lactococcus lactis subsp. cremoris KW2	55.34	99.038	0.548
comYC	Streptococcus suis isolate S10	63.636	84.615	0.538
comGC	Staphylococcus aureus MW2	45.882	81.731	0.375
comGC	Staphylococcus aureus N315	45.882	81.731	0.375