Detailed information NTG0532191

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: JOA01_RS08850
• Genome accession: NZ_CP069079
• Coordinates: 1752011..1752289 (-)
• Length: 92 a.a.
• NCBI ID: WP_217374331.1
• Uniprot ID: -
• Organism: Streptococcus parasuis strain BS26
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1747011..1757289

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
JOA01_RS08815 (JOA01_08820)	-	1747437..1747988 (-)	552	WP_217374325.1	folate family ECF transporter S component	-
JOA01_RS08820 (JOA01_08825)	-	1748243..1749430 (-)	1188	WP_217374326.1	acetate kinase	-
JOA01_RS08825 (JOA01_08830)	comYH	1749480..1750433 (-)	954	WP_217374327.1	class I SAM-dependent methyltransferase	Machinery gene
JOA01_RS08830 (JOA01_08835)	comGG	1750453..1750953 (-)	501	WP_217374328.1	competence type IV pilus minor pilin ComGG	-
JOA01_RS08835 (JOA01_08840)	comYF	1750931..1751365 (-)	435	WP_217374329.1	competence type IV pilus minor pilin ComGF	Machinery gene
JOA01_RS08840 (JOA01_08845)	comGE	1751352..1751645 (-)	294	WP_217374330.1	competence type IV pilus minor pilin ComGE	-
JOA01_RS08845 (JOA01_08850)	comGD	1751617..1752021 (-)	405	WP_160864045.1	competence type IV pilus minor pilin ComGD	-
JOA01_RS08850 (JOA01_08855)	comYC	1752011..1752289 (-)	279	WP_217374331.1	competence type IV pilus major pilin ComGC	Machinery gene
JOA01_RS08855 (JOA01_08860)	comYB	1752291..1753328 (-)	1038	WP_217374332.1	competence type IV pilus assembly protein ComGB	Machinery gene
JOA01_RS08860 (JOA01_08865)	comYA	1753240..1754190 (-)	951	WP_217374333.1	competence type IV pilus ATPase ComGA	Machinery gene
JOA01_RS08865 (JOA01_08870)	-	1754278..1755228 (+)	951	WP_217375199.1	S66 peptidase family protein	-
JOA01_RS08870 (JOA01_08875)	-	1755289..1755630 (-)	342	WP_217374334.1	DUF1033 family protein	-

Sequence

Protein

• Length: 92 a.a.
• Molecular weight: 10588.57 Da
• Isoelectric Point: 7.0112

>NTDB_id=532191 JOA01_RS08850 WP_217374331.1 1752011..1752289(-) (comYC) [Streptococcus parasuis strain BS26]
MKKMLKKKVKGFTLVEMLVVLGIISILLLLFVPNLSKQKQKIQEDGNAVVVKVVESQMDIYELEHGVRPTAEELYNQQMI
TEDQLEKYNNVP

Nucleotide

• Length: 279 bp

>NTDB_id=532191 JOA01_RS08850 WP_217374331.1 1752011..1752289(-) (comYC) [Streptococcus parasuis strain BS26]
ATGAAAAAAATGTTGAAAAAGAAAGTCAAAGGATTCACTTTGGTCGAAATGTTAGTGGTGCTTGGAATTATTAGTATTCT
CTTACTATTATTTGTGCCAAATCTCAGTAAGCAAAAGCAAAAAATACAAGAAGACGGCAATGCGGTGGTTGTAAAAGTTG
TTGAAAGTCAAATGGACATTTACGAATTGGAGCATGGTGTTCGTCCAACAGCGGAAGAATTATATAATCAGCAGATGATA
ACTGAAGATCAACTAGAAAAATATAATAATGTACCTTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus suis isolate S10	63.736	98.913	0.63
comGC/cglC	Streptococcus mitis SK321	55.914	100	0.565
comGC/cglC	Streptococcus pneumoniae TIGR4	55.435	100	0.554
comGC/cglC	Streptococcus pneumoniae Rx1	55.435	100	0.554
comGC/cglC	Streptococcus pneumoniae D39	55.435	100	0.554
comGC/cglC	Streptococcus pneumoniae R6	55.435	100	0.554
comGC/cglC	Streptococcus mitis NCTC 12261	55.435	100	0.554
comYC	Streptococcus gordonii str. Challis substr. CH1	55.056	96.739	0.533
comGC	Lactococcus lactis subsp. cremoris KW2	54.444	97.826	0.533
comYC	Streptococcus mutans UA159	53.333	97.826	0.522
comYC	Streptococcus mutans UA140	53.333	97.826	0.522
comGC	Staphylococcus aureus MW2	46.835	85.87	0.402
comGC	Staphylococcus aureus N315	46.835	85.87	0.402
comGC	Bacillus subtilis subsp. subtilis str. 168	46.667	81.522	0.38