Detailed information NTG0506281

Bioinformatically predicted

Overview

• Name: comGC/cglC
• Type: Machinery gene
• Locus tag: I2432_RS00760
• Genome accession: NZ_CP065054
• Coordinates: 130212..130535 (+)
• Length: 107 a.a.
• NCBI ID: WP_206158899.1
• Uniprot ID: -
• Organism: Streptococcus equi subsp. zooepidemicus strain SEZ13
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 125212..135535

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
I2432_RS00740 (LJFMMFNO_00146)	-	125473..127476 (+)	2004	Protein_111	DUF1430 domain-containing protein	-
I2432_RS00745 (LJFMMFNO_00148)	-	127478..128125 (+)	648	WP_206158896.1	ATP-binding cassette domain-containing protein	-
I2432_RS00750 (LJFMMFNO_00149)	comGA/cglA	128306..129244 (+)	939	WP_206158897.1	competence type IV pilus ATPase ComGA	Machinery gene
I2432_RS00755 (LJFMMFNO_00150)	comYB	129177..130211 (+)	1035	WP_249093266.1	competence type IV pilus assembly protein ComGB	Machinery gene
I2432_RS00760 (LJFMMFNO_00151)	comGC/cglC	130212..130535 (+)	324	WP_206158899.1	competence type IV pilus major pilin ComGC	Machinery gene
I2432_RS00765 (LJFMMFNO_00152)	comGD	130513..130938 (+)	426	WP_012514783.1	competence type IV pilus minor pilin ComGD	-
I2432_RS00770 (LJFMMFNO_00153)	comGE	130895..131185 (+)	291	WP_206158900.1	competence type IV pilus minor pilin ComGE	-
I2432_RS00775 (LJFMMFNO_00154)	comYF	131172..131606 (+)	435	WP_012677237.1	competence type IV pilus minor pilin ComGF	Machinery gene
I2432_RS00780 (LJFMMFNO_00155)	comGG	131584..131946 (+)	363	WP_206152302.1	competence type IV pilus minor pilin ComGG	-
I2432_RS00785 (LJFMMFNO_00156)	comYH	132008..132961 (+)	954	WP_037580627.1	class I SAM-dependent methyltransferase	Machinery gene
I2432_RS00790 (LJFMMFNO_00157)	-	133021..134220 (+)	1200	WP_165627047.1	acetate kinase	-
I2432_RS00795 (LJFMMFNO_00158)	-	134831..135013 (-)	183	WP_206158901.1	class IIb bacteriocin, lactobin A/cerein 7B family	-
I2432_RS00800 (LJFMMFNO_00159)	-	135031..135282 (-)	252	WP_206158902.1	bacteriocin class II family protein	-

Sequence

Protein

• Length: 107 a.a.
• Molecular weight: 12181.19 Da
• Isoelectric Point: 8.4057

>NTDB_id=506281 I2432_RS00760 WP_206158899.1 130212..130535(+) (comGC/cglC) [Streptococcus equi subsp. zooepidemicus strain SEZ13]
MKMRLSTLKDQAVQAFTLLEMLLVLLIISVLMLLFVPNLSKQKDKVTDTGNAAVVKLVENQAELYELSHGEKPSLKQLQE
DGSISDKQQKAYQDYYAKHKDETKKLN

Nucleotide

• Length: 324 bp

>NTDB_id=506281 I2432_RS00760 WP_206158899.1 130212..130535(+) (comGC/cglC) [Streptococcus equi subsp. zooepidemicus strain SEZ13]
ATGAAAATGAGATTATCAACCTTAAAAGATCAAGCTGTTCAGGCCTTCACTTTACTGGAAATGCTTCTGGTTTTGTTAAT
CATTAGTGTTTTGATGCTGTTATTTGTTCCAAATTTAAGTAAACAAAAGGATAAGGTGACAGATACAGGCAATGCTGCGG
TGGTAAAGCTAGTTGAAAATCAGGCAGAGCTTTATGAATTATCACATGGGGAAAAGCCAAGCCTGAAGCAACTGCAAGAG
GATGGAAGCATCAGTGACAAGCAACAAAAGGCTTATCAGGATTATTATGCAAAGCATAAAGATGAAACTAAGAAGCTCAA
TTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (14-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC/cglC	Streptococcus mitis SK321	59.813	100	0.598
comGC/cglC	Streptococcus pneumoniae Rx1	57.944	100	0.579
comGC/cglC	Streptococcus pneumoniae D39	57.944	100	0.579
comGC/cglC	Streptococcus pneumoniae R6	57.944	100	0.579
comGC/cglC	Streptococcus pneumoniae TIGR4	57.944	100	0.579
comYC	Streptococcus gordonii str. Challis substr. CH1	61.386	94.393	0.579
comGC/cglC	Streptococcus mitis NCTC 12261	61.616	92.523	0.57
comYC	Streptococcus mutans UA140	59.794	90.654	0.542
comYC	Streptococcus mutans UA159	59.794	90.654	0.542
comGC	Lactococcus lactis subsp. cremoris KW2	56.842	88.785	0.505
comYC	Streptococcus suis isolate S10	60	74.766	0.449
comGC	Staphylococcus aureus MW2	50	72.897	0.364
comGC	Staphylococcus aureus N315	50	72.897	0.364