Detailed information NTG0049719

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: SSUD9_RS00815
• Genome accession: NC_017620
• Coordinates: 127766..128047 (+)
• Length: 93 a.a.
• NCBI ID: WP_002936550.1
• Uniprot ID: G7SD61
• Organism: Streptococcus suis D9
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 122766..133047

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SSUD9_RS00795 (SSUD9_0133)	-	124429..124794 (+)	366	WP_002936568.1	DUF1033 family protein	-
SSUD9_RS00800 (SSUD9_0134)	-	124829..125779 (-)	951	WP_014636751.1	S66 family peptidase	-
SSUD9_RS00805 (SSUD9_0135)	comYA	125865..126815 (+)	951	WP_002936562.1	competence type IV pilus ATPase ComGA	Machinery gene
SSUD9_RS00810 (SSUD9_0136)	comYB	126727..127764 (+)	1038	WP_255195823.1	competence type IV pilus assembly protein ComGB	Machinery gene
SSUD9_RS00815 (SSUD9_0137)	comYC	127766..128047 (+)	282	WP_002936550.1	competence type IV pilus major pilin ComGC	Machinery gene
SSUD9_RS00820 (SSUD9_0138)	comGD	128028..128435 (+)	408	WP_014636753.1	competence type IV pilus minor pilin ComGD	-
SSUD9_RS00825 (SSUD9_0139)	comYE	128407..128700 (+)	294	WP_002936548.1	competence type IV pilus minor pilin ComGE	Machinery gene
SSUD9_RS00830 (SSUD9_0140)	comGF/cglF	128687..129121 (+)	435	WP_002936547.1	competence type IV pilus minor pilin ComGF	Machinery gene
SSUD9_RS00835 (SSUD9_0141)	comGG	129099..129509 (+)	411	WP_002936546.1	competence type IV pilus minor pilin ComGG	-
SSUD9_RS00840 (SSUD9_0142)	comYH	129566..130519 (+)	954	WP_014636755.1	class I SAM-dependent methyltransferase	Machinery gene
SSUD9_RS00845 (SSUD9_0143)	-	130569..131756 (+)	1188	WP_002936543.1	acetate kinase	-
SSUD9_RS00850 (SSUD9_0144)	-	132071..132622 (+)	552	WP_014636756.1	folate family ECF transporter S component	-

Sequence

Protein

• Length: 93 a.a.
• Molecular weight: 10452.31 Da
• Isoelectric Point: 5.1667

>NTDB_id=49719 SSUD9_RS00815 WP_002936550.1 127766..128047(+) (comYC) [Streptococcus suis D9]
MKKLVEMKVKGFTLVEMLVVLGIISLLLLLFVPNLSKQKDAVQEKGNAAVVKVVESQMELYELEHDEEATVEDLQQAGYI
TEKQAKQYATAKK

Nucleotide

• Length: 282 bp

>NTDB_id=49719 SSUD9_RS00815 WP_002936550.1 127766..128047(+) (comYC) [Streptococcus suis D9]
ATGAAAAAATTAGTTGAAATGAAGGTAAAAGGGTTCACTCTGGTGGAAATGTTAGTCGTTTTGGGGATCATTAGCCTGCT
CTTGCTCTTATTTGTGCCAAATTTGAGCAAACAAAAGGATGCTGTTCAAGAGAAAGGAAATGCTGCCGTTGTCAAAGTAG
TGGAGAGTCAGATGGAGCTCTACGAATTGGAACATGACGAGGAAGCAACGGTGGAGGATTTGCAACAGGCAGGTTATATT
ACTGAAAAACAAGCAAAACAGTATGCTACGGCGAAAAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

3D structure

• AlphaFold DB: G7SD61

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus suis isolate S10	92.473	100	0.925
comGC/cglC	Streptococcus pneumoniae TIGR4	68.182	94.624	0.645
comGC/cglC	Streptococcus pneumoniae Rx1	68.182	94.624	0.645
comGC/cglC	Streptococcus pneumoniae D39	68.182	94.624	0.645
comGC/cglC	Streptococcus pneumoniae R6	68.182	94.624	0.645
comGC/cglC	Streptococcus mitis SK321	69.412	91.398	0.634
comGC/cglC	Streptococcus mitis NCTC 12261	69.412	91.398	0.634
comYC	Streptococcus gordonii str. Challis substr. CH1	65.169	95.699	0.624
comYC	Streptococcus mutans UA140	61.364	94.624	0.581
comYC	Streptococcus mutans UA159	61.364	94.624	0.581
comGC	Lactococcus lactis subsp. cremoris KW2	59.091	94.624	0.559
comGC	Staphylococcus aureus MW2	50	83.871	0.419
comGC	Staphylococcus aureus N315	50	83.871	0.419
comGC	Bacillus subtilis subsp. subtilis str. 168	46.667	80.645	0.376