Detailed information    

insolico Bioinformatically predicted

Overview

Name   comX/sigX   Type   Regulator
Locus tag   H1R75_RS01955 Genome accession   NZ_CP059471
Coordinates   345189..345665 (+) Length   158 a.a.
NCBI ID   WP_182001570.1    Uniprot ID   -
Organism   Streptococcus equinus strain MDC1     
Function   activate transcription of late competence genes (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 315071..345665 345189..345665 within 0


Gene organization within MGE regions


Location: 315071..345665
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H1R75_RS01815 (H1R75_01815) - 315071..315415 (+) 345 WP_182001557.1 helix-turn-helix domain-containing protein -
  H1R75_RS01820 (H1R75_01820) - 315539..315703 (-) 165 Protein_307 IS3 family transposase -
  H1R75_RS01825 (H1R75_01825) - 315746..316507 (-) 762 WP_182001558.1 helix-turn-helix domain-containing protein -
  H1R75_RS01830 (H1R75_01830) - 316661..317944 (+) 1284 WP_182001559.1 radical SAM/SPASM domain-containing protein -
  H1R75_RS01835 (H1R75_01835) - 317957..318199 (+) 243 WP_182001560.1 hypothetical protein -
  H1R75_RS01840 (H1R75_01840) - 318527..320347 (+) 1821 WP_182001561.1 DUF1611 domain-containing protein -
  H1R75_RS01845 (H1R75_01845) - 320371..321948 (+) 1578 WP_182001562.1 ATP-binding cassette domain-containing protein -
  H1R75_RS01850 (H1R75_01850) - 321941..322774 (+) 834 WP_182001563.1 class I SAM-dependent methyltransferase -
  H1R75_RS01855 (H1R75_01855) - 322777..323589 (+) 813 WP_182001564.1 transglutaminase domain-containing protein -
  H1R75_RS01860 (H1R75_01860) - 323607..325076 (+) 1470 WP_182001565.1 hypothetical protein -
  H1R75_RS01865 (H1R75_01865) - 325394..325540 (-) 147 Protein_316 IS3 family transposase -
  H1R75_RS01870 (H1R75_01870) - 325741..325920 (+) 180 WP_157339164.1 helix-turn-helix transcriptional regulator -
  H1R75_RS01875 (H1R75_01875) - 326127..326999 (+) 873 WP_235686240.1 ImmA/IrrE family metallo-endopeptidase -
  H1R75_RS01880 (H1R75_01880) - 327073..327705 (+) 633 WP_182001566.1 ATP-binding protein -
  H1R75_RS01885 (H1R75_01885) - 328040..328180 (+) 141 WP_141348105.1 SapB/AmfS family lanthipeptide -
  H1R75_RS01890 (H1R75_01890) - 328342..329958 (+) 1617 WP_141348106.1 ABC transporter ATP-binding protein -
  H1R75_RS01895 (H1R75_01895) - 329971..332580 (+) 2610 WP_141348107.1 lanthionine synthetase LanC family protein -
  H1R75_RS01900 (H1R75_01900) - 332606..334546 (+) 1941 WP_182001567.1 prolyl oligopeptidase family serine peptidase -
  H1R75_RS01905 (H1R75_01905) - 334575..335309 (+) 735 WP_182001568.1 ABC transporter ATP-binding protein -
  H1R75_RS01910 (H1R75_01910) - 335327..336649 (+) 1323 WP_182001569.1 FtsX-like permease family protein -
  H1R75_RS01915 (H1R75_01915) - 336824..337440 (-) 617 Protein_326 LysE family translocator -
  H1R75_RS09745 - 337442..338437 (-) 996 WP_074561270.1 hypothetical protein -
  H1R75_RS01925 (H1R75_01925) - 338648..339001 (+) 354 WP_234793138.1 hypothetical protein -
  H1R75_RS01955 (H1R75_01955) comX/sigX 345189..345665 (+) 477 WP_182001570.1 sigma-70 family RNA polymerase sigma factor Regulator

Sequence

Protein


Download         Length: 158 a.a.        Molecular weight: 19314.13 Da        Isoelectric Point: 8.7333

>NTDB_id=469808 H1R75_RS01955 WP_182001570.1 345189..345665(+) (comX/sigX) [Streptococcus equinus strain MDC1]
MDFESYFETVKPIILKLRRHYFVKLWDYDDWIQEGRIVFFKLLQEHPEVLINEGRRYTYFKTKFSNHVKDTIRHQESFKR
KFNRMPYEEIGEISHCVPQVNFFEVADFIAYRDSLSQLKATLSLEEQEKLAKVVRGERFEGKKAFLRQIEPYFSDFKH

Nucleotide


Download         Length: 477 bp        

>NTDB_id=469808 H1R75_RS01955 WP_182001570.1 345189..345665(+) (comX/sigX) [Streptococcus equinus strain MDC1]
GTGGATTTTGAAAGCTATTTTGAAACTGTAAAACCAATTATTTTAAAATTAAGACGTCATTACTTTGTGAAATTATGGGA
TTATGACGACTGGATTCAGGAAGGGCGTATTGTCTTTTTCAAACTACTGCAAGAACATCCTGAGGTTCTGATTAATGAGG
GAAGACGCTATACTTACTTCAAGACAAAATTTTCTAATCATGTAAAGGATACCATCCGCCATCAGGAATCCTTTAAACGT
AAATTTAATCGTATGCCTTATGAAGAAATAGGTGAGATTAGTCATTGTGTGCCTCAGGTTAATTTTTTTGAAGTGGCAGA
CTTTATTGCTTACCGAGATAGTTTGTCTCAATTAAAAGCAACTTTAAGCTTAGAAGAGCAAGAAAAGCTAGCAAAAGTAG
TCAGAGGGGAACGATTTGAAGGGAAGAAAGCCTTCTTACGCCAAATTGAACCTTACTTTTCTGACTTTAAGCACTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.