NTDB

Overview

Name	comYC	Type	Machinery gene
Locus tag	FOC73_RS04710	Genome accession	NZ_CP053998
Coordinates	990783..991097 (-)	Length	104 a.a.
NCBI ID	WP_037611125.1	Uniprot ID	-
Organism	Streptococcus salivarius strain FDAARGOS_771
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 985783..996097

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
FOC73_RS04670 (FOC73_04670)	-	986047..986703 (-)	657	WP_002885876.1	CPBP family intramembrane glutamic endopeptidase	-
FOC73_RS04675 (FOC73_04675)	-	986715..986912 (-)	198	WP_002885716.1	helix-turn-helix transcriptional regulator	-
FOC73_RS04680 (FOC73_04680)	-	987163..988356 (-)	1194	WP_002885831.1	acetate kinase	-
FOC73_RS04685 (FOC73_04685)	comYH	988413..989369 (-)	957	WP_002885753.1	class I SAM-dependent methyltransferase	Machinery gene
FOC73_RS04690 (FOC73_04690)	comGG	989414..989731 (-)	318	WP_037605448.1	competence type IV pilus minor pilin ComGG	-
FOC73_RS04695 (FOC73_04695)	comYF	989709..990146 (-)	438	WP_002885762.1	competence type IV pilus minor pilin ComGF	Machinery gene
FOC73_RS04700 (FOC73_04700)	comGE	990133..990363 (-)	231	WP_002885825.1	competence type IV pilus minor pilin ComGE	-
FOC73_RS04705 (FOC73_04705)	comYD	990395..990823 (-)	429	WP_014632541.1	competence type IV pilus minor pilin ComGD	Machinery gene
FOC73_RS04710 (FOC73_04710)	comYC	990783..991097 (-)	315	WP_037611125.1	competence type IV pilus major pilin ComGC	Machinery gene
FOC73_RS04715 (FOC73_04715)	comYB	991106..992206 (-)	1101	WP_157747911.1	competence type IV pilus assembly protein ComGB	Machinery gene
FOC73_RS04720 (FOC73_04720)	comYA	992088..993029 (-)	942	WP_002885658.1	competence type IV pilus ATPase ComGA	Machinery gene
FOC73_RS04725 (FOC73_04725)	-	993109..993471 (-)	363	WP_002885749.1	DUF1033 family protein	-

Sequence

Protein

Download Length: 104 a.a. Molecular weight: 11428.31 Da Isoelectric Point: 9.7150

                                >NTDB_id=449943 FOC73_RS04710 WP_037611125.1 990783..991097(-) (comYC) [Streptococcus salivarius strain FDAARGOS_771]

MKKLNAVKLRAFTLIEMLVVLLIISILLLLFVPNLSKQKDSVKETGNAAVVKVVDSQAELYEMKNNKTASLAALVSEGQI

TQKQADSYNDYYAKHGGESRSVAN

Nucleotide

Download Length: 315 bp

                                >NTDB_id=449943 FOC73_RS04710 WP_037611125.1 990783..991097(-) (comYC) [Streptococcus salivarius strain FDAARGOS_771]

TTGAAAAAATTGAATGCCGTTAAATTACGTGCTTTTACGCTGATTGAAATGCTGGTCGTGCTTCTCATTATCAGTATTCT

CCTTTTGCTCTTTGTACCTAACTTGAGCAAGCAGAAGGATTCTGTTAAAGAGACTGGAAATGCGGCTGTGGTCAAGGTCG

TGGATTCTCAAGCAGAACTTTATGAAATGAAGAATAACAAGACAGCTAGCTTAGCCGCTCTTGTTTCAGAAGGTCAAATC

ACGCAAAAACAGGCAGATTCATACAATGATTACTATGCGAAACATGGTGGCGAAAGCCGCTCAGTGGCCAATTAG

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(10-30)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comYC	Streptococcus mutans UA140	70.192	100	0.702
comYC	Streptococcus mutans UA159	70.192	100	0.702
comYC	Streptococcus gordonii str. Challis substr. CH1	64.762	100	0.654
comGC/cglC	Streptococcus mitis SK321	63.636	95.192	0.606
comGC/cglC	Streptococcus mitis NCTC 12261	59.406	97.115	0.577
comGC	Lactococcus lactis subsp. cremoris KW2	58.416	97.115	0.567
comGC/cglC	Streptococcus pneumoniae R6	59.596	95.192	0.567
comGC/cglC	Streptococcus pneumoniae Rx1	59.596	95.192	0.567
comGC/cglC	Streptococcus pneumoniae TIGR4	59.596	95.192	0.567
comGC/cglC	Streptococcus pneumoniae D39	59.596	95.192	0.567
comYC	Streptococcus suis isolate S10	61.364	84.615	0.519
comGC	Staphylococcus aureus MW2	50	75	0.375
comGC	Staphylococcus aureus N315	50	75	0.375

Detailed information NTG0449943