Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | GRI05_RS09320 | Genome accession | NZ_CP047248 |
| Coordinates | 1895989..1896402 (-) | Length | 137 a.a. |
| NCBI ID | WP_192584836.1 | Uniprot ID | - |
| Organism | Streptococcus suis strain LSM178 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1869400..1912429 | 1895989..1896402 | within | 0 |
Gene organization within MGE regions
Location: 1869400..1912429
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GRI05_RS09155 (GRI05_09355) | rpsB | 1869400..1870176 (-) | 777 | WP_012775356.1 | 30S ribosomal protein S2 | - |
| GRI05_RS09160 (GRI05_09360) | - | 1870523..1871035 (-) | 513 | WP_012775452.1 | adenylate kinase | - |
| GRI05_RS09170 (GRI05_09370) | - | 1871862..1872266 (-) | 405 | WP_029185623.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| GRI05_RS09175 (GRI05_09375) | - | 1872326..1872511 (-) | 186 | WP_024381116.1 | type II toxin-antitoxin system HicA family toxin | - |
| GRI05_RS09180 (GRI05_09380) | - | 1872665..1874071 (-) | 1407 | WP_192584820.1 | peptidoglycan amidohydrolase family protein | - |
| GRI05_RS09185 (GRI05_09385) | - | 1874074..1874403 (-) | 330 | WP_024402342.1 | phage holin | - |
| GRI05_RS09190 (GRI05_09390) | - | 1874406..1874705 (-) | 300 | WP_029171103.1 | hypothetical protein | - |
| GRI05_RS09195 (GRI05_09395) | - | 1874717..1875058 (-) | 342 | WP_192584821.1 | hypothetical protein | - |
| GRI05_RS09200 (GRI05_09400) | - | 1875061..1875291 (-) | 231 | WP_044675236.1 | hypothetical protein | - |
| GRI05_RS09205 (GRI05_09405) | - | 1875308..1880254 (-) | 4947 | WP_192584822.1 | phage tail spike protein | - |
| GRI05_RS09210 (GRI05_09410) | - | 1880255..1880977 (-) | 723 | WP_192584823.1 | phage tail protein | - |
| GRI05_RS09215 (GRI05_09415) | - | 1880980..1884129 (-) | 3150 | WP_192584824.1 | phage tail tape measure protein | - |
| GRI05_RS09220 (GRI05_09420) | - | 1884437..1884856 (-) | 420 | WP_105142105.1 | hypothetical protein | - |
| GRI05_RS09225 (GRI05_09425) | - | 1884868..1885443 (-) | 576 | WP_044475325.1 | major tail protein | - |
| GRI05_RS09230 (GRI05_09430) | - | 1885456..1885779 (-) | 324 | WP_024402334.1 | hypothetical protein | - |
| GRI05_RS09235 (GRI05_09435) | - | 1885776..1886129 (-) | 354 | WP_192584825.1 | HK97 gp10 family phage protein | - |
| GRI05_RS09240 (GRI05_09440) | - | 1886126..1886425 (-) | 300 | WP_192584826.1 | phage head closure protein | - |
| GRI05_RS09245 (GRI05_09445) | - | 1886412..1886693 (-) | 282 | WP_043035806.1 | hypothetical protein | - |
| GRI05_RS09250 (GRI05_09450) | - | 1886696..1886998 (-) | 303 | WP_192584827.1 | hypothetical protein | - |
| GRI05_RS09255 (GRI05_09455) | - | 1887010..1888176 (-) | 1167 | WP_192584828.1 | phage major capsid protein | - |
| GRI05_RS09260 (GRI05_09460) | - | 1888173..1888751 (-) | 579 | WP_192584829.1 | HK97 family phage prohead protease | - |
| GRI05_RS09265 (GRI05_09465) | - | 1888738..1889940 (-) | 1203 | WP_192584830.1 | phage portal protein | - |
| GRI05_RS09270 (GRI05_09470) | - | 1889963..1891738 (-) | 1776 | WP_192584831.1 | terminase large subunit | - |
| GRI05_RS09275 (GRI05_09475) | - | 1891731..1892120 (-) | 390 | WP_044675115.1 | P27 family phage terminase small subunit | - |
| GRI05_RS09280 (GRI05_09480) | - | 1892231..1892563 (-) | 333 | WP_029694579.1 | HNH endonuclease | - |
| GRI05_RS09285 (GRI05_09485) | - | 1892848..1893390 (-) | 543 | WP_044475317.1 | site-specific integrase | - |
| GRI05_RS09290 (GRI05_09490) | - | 1893507..1894166 (-) | 660 | WP_225938934.1 | hypothetical protein | - |
| GRI05_RS09295 (GRI05_09495) | - | 1894298..1894693 (-) | 396 | WP_099776261.1 | hypothetical protein | - |
| GRI05_RS09300 (GRI05_09500) | - | 1894677..1894946 (-) | 270 | WP_192584832.1 | hypothetical protein | - |
| GRI05_RS09305 (GRI05_09505) | - | 1894943..1895464 (-) | 522 | WP_192584833.1 | hypothetical protein | - |
| GRI05_RS09310 (GRI05_09510) | - | 1895457..1895636 (-) | 180 | WP_192584834.1 | hypothetical protein | - |
| GRI05_RS09315 (GRI05_09515) | - | 1895629..1895976 (-) | 348 | WP_192584835.1 | hypothetical protein | - |
| GRI05_RS09320 (GRI05_09520) | ssb | 1895989..1896402 (-) | 414 | WP_192584836.1 | single-stranded DNA-binding protein | Machinery gene |
| GRI05_RS09325 (GRI05_09525) | - | 1896413..1896601 (-) | 189 | WP_192584837.1 | hypothetical protein | - |
| GRI05_RS09330 (GRI05_09530) | - | 1896586..1896876 (-) | 291 | WP_338135450.1 | DUF3310 domain-containing protein | - |
| GRI05_RS09335 (GRI05_09535) | - | 1896894..1897133 (-) | 240 | WP_371318548.1 | DUF1372 family protein | - |
| GRI05_RS09340 (GRI05_09540) | - | 1897196..1897681 (-) | 486 | WP_192584839.1 | MazG-like family protein | - |
| GRI05_RS09345 (GRI05_09545) | - | 1897674..1897925 (-) | 252 | WP_044475308.1 | hypothetical protein | - |
| GRI05_RS09350 (GRI05_09550) | - | 1897922..1898161 (-) | 240 | WP_225938936.1 | hypothetical protein | - |
| GRI05_RS09355 (GRI05_09555) | - | 1898167..1898628 (-) | 462 | WP_192584840.1 | class I SAM-dependent methyltransferase | - |
| GRI05_RS09360 (GRI05_09560) | - | 1898628..1899449 (-) | 822 | WP_192584841.1 | ATP-binding protein | - |
| GRI05_RS09365 (GRI05_09565) | - | 1899450..1900208 (-) | 759 | WP_192584842.1 | conserved phage C-terminal domain-containing protein | - |
| GRI05_RS09370 (GRI05_09570) | dnaB | 1900211..1901539 (-) | 1329 | WP_192584843.1 | replicative DNA helicase | - |
| GRI05_RS09375 (GRI05_09575) | - | 1901511..1901684 (-) | 174 | WP_153598786.1 | hypothetical protein | - |
| GRI05_RS09380 (GRI05_09580) | - | 1901687..1901941 (-) | 255 | WP_043035785.1 | hypothetical protein | - |
| GRI05_RS09385 (GRI05_09585) | - | 1901943..1902131 (-) | 189 | WP_044685832.1 | hypothetical protein | - |
| GRI05_RS09390 (GRI05_09590) | - | 1902128..1902412 (-) | 285 | WP_044685831.1 | hypothetical protein | - |
| GRI05_RS09395 (GRI05_09595) | - | 1902434..1902799 (-) | 366 | WP_044685830.1 | hypothetical protein | - |
| GRI05_RS09400 (GRI05_09600) | - | 1902799..1903011 (-) | 213 | WP_043033188.1 | helix-turn-helix domain-containing protein | - |
| GRI05_RS09405 (GRI05_09605) | - | 1903074..1903433 (+) | 360 | WP_043033187.1 | hypothetical protein | - |
| GRI05_RS09410 (GRI05_09610) | - | 1903417..1903584 (-) | 168 | WP_153582878.1 | hypothetical protein | - |
| GRI05_RS09415 (GRI05_09620) | - | 1903867..1904229 (+) | 363 | WP_000114553.1 | helix-turn-helix domain-containing protein | - |
| GRI05_RS09420 (GRI05_09625) | - | 1904236..1904616 (+) | 381 | WP_192584844.1 | ImmA/IrrE family metallo-endopeptidase | - |
| GRI05_RS09425 (GRI05_09630) | - | 1904669..1905073 (+) | 405 | WP_192584845.1 | DUF4429 domain-containing protein | - |
| GRI05_RS09430 (GRI05_09635) | - | 1905198..1906268 (+) | 1071 | WP_044685829.1 | site-specific integrase | - |
| GRI05_RS09435 (GRI05_09645) | - | 1906382..1911460 (-) | 5079 | WP_043028958.1 | S8 family serine peptidase | - |
| GRI05_RS09440 (GRI05_09650) | nusG | 1911604..1912143 (-) | 540 | WP_002940254.1 | transcription termination/antitermination protein NusG | - |
| GRI05_RS09445 (GRI05_09655) | secE | 1912253..1912429 (-) | 177 | WP_002940255.1 | preprotein translocase subunit SecE | - |
Sequence
Protein
Download Length: 137 a.a. Molecular weight: 15476.33 Da Isoelectric Point: 4.8723
>NTDB_id=411877 GRI05_RS09320 WP_192584836.1 1895989..1896402(-) (ssb) [Streptococcus suis strain LSM178]
MINNVTLIGRLTRDVELRYTPNNVAVGAFTLAVNRNFKNAAGDREADFINCVIWNKQAENLANWTKKGHLIGITGRIQTR
SYDNQQGQRVYVTEVVAESFQILEKRDNAANQASMEDQMPPNFASQPMDITDDDLPF
MINNVTLIGRLTRDVELRYTPNNVAVGAFTLAVNRNFKNAAGDREADFINCVIWNKQAENLANWTKKGHLIGITGRIQTR
SYDNQQGQRVYVTEVVAESFQILEKRDNAANQASMEDQMPPNFASQPMDITDDDLPF
Nucleotide
Download Length: 414 bp
>NTDB_id=411877 GRI05_RS09320 WP_192584836.1 1895989..1896402(-) (ssb) [Streptococcus suis strain LSM178]
ATGATCAATAATGTTACTTTAATTGGCCGATTGACCAGGGATGTTGAGCTACGTTATACACCTAATAATGTTGCAGTAGG
CGCATTCACGCTGGCCGTCAACCGTAATTTTAAGAATGCAGCTGGAGACCGTGAGGCAGATTTTATCAACTGCGTCATTT
GGAACAAGCAAGCTGAAAACTTGGCAAACTGGACTAAGAAAGGTCATCTGATTGGCATTACAGGTCGAATCCAGACACGG
AGCTACGACAATCAGCAAGGGCAACGTGTCTACGTTACTGAGGTAGTCGCTGAAAGTTTCCAAATACTTGAAAAGCGTGA
TAATGCAGCCAATCAAGCAAGCATGGAAGACCAGATGCCACCGAATTTCGCTAGTCAGCCTATGGATATTACAGATGACG
ACTTGCCGTTTTAA
ATGATCAATAATGTTACTTTAATTGGCCGATTGACCAGGGATGTTGAGCTACGTTATACACCTAATAATGTTGCAGTAGG
CGCATTCACGCTGGCCGTCAACCGTAATTTTAAGAATGCAGCTGGAGACCGTGAGGCAGATTTTATCAACTGCGTCATTT
GGAACAAGCAAGCTGAAAACTTGGCAAACTGGACTAAGAAAGGTCATCTGATTGGCATTACAGGTCGAATCCAGACACGG
AGCTACGACAATCAGCAAGGGCAACGTGTCTACGTTACTGAGGTAGTCGCTGAAAGTTTCCAAATACTTGAAAAGCGTGA
TAATGCAGCCAATCAAGCAAGCATGGAAGACCAGATGCCACCGAATTTCGCTAGTCAGCCTATGGATATTACAGATGACG
ACTTGCCGTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.353 |
100 |
0.65 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
48.837 |
100 |
0.613 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
46.763 |
100 |
0.474 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
53.982 |
82.482 |
0.445 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
43.066 |
100 |
0.431 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.066 |
100 |
0.431 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
42.336 |
100 |
0.423 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
42.336 |
100 |
0.423 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
42.336 |
100 |
0.423 |
| ssbB/cilA | Streptococcus mitis SK321 |
42.336 |
100 |
0.423 |
| ssbA | Streptococcus mutans UA159 |
40.876 |
100 |
0.409 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
46.018 |
82.482 |
0.38 |
| ssb | Neisseria meningitidis MC58 |
29.651 |
100 |
0.372 |
| ssb | Vibrio cholerae strain A1552 |
28.902 |
100 |
0.365 |
| ssb | Neisseria gonorrhoeae MS11 |
29.07 |
100 |
0.365 |