Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   HNO12_RS11905 Genome accession   NZ_CP053376
Coordinates   2508063..2508440 (-) Length   125 a.a.
NCBI ID   WP_003153092.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain WF02     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2503063..2513440
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HNO12_RS11865 (HNO12_11900) - 2503561..2504355 (+) 795 WP_003153106.1 YqhG family protein -
  HNO12_RS11870 (HNO12_11905) sinI 2504532..2504705 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  HNO12_RS11875 (HNO12_11910) sinR 2504739..2505074 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  HNO12_RS11880 (HNO12_11915) tasA 2505122..2505907 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  HNO12_RS11885 (HNO12_11920) sipW 2505971..2506555 (-) 585 WP_003153100.1 signal peptidase I SipW -
  HNO12_RS11890 (HNO12_11925) tapA 2506527..2507198 (-) 672 WP_024085598.1 amyloid fiber anchoring/assembly protein TapA -
  HNO12_RS11895 (HNO12_11930) - 2507458..2507787 (+) 330 WP_024085599.1 DUF3889 domain-containing protein -
  HNO12_RS11900 (HNO12_11935) - 2507827..2508006 (-) 180 WP_003153093.1 YqzE family protein -
  HNO12_RS11905 (HNO12_11940) comGG 2508063..2508440 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  HNO12_RS11910 (HNO12_11945) comGF 2508441..2508941 (-) 501 WP_223203779.1 competence type IV pilus minor pilin ComGF Machinery gene
  HNO12_RS11915 (HNO12_11950) comGE 2508850..2509164 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  HNO12_RS11920 (HNO12_11955) comGD 2509148..2509585 (-) 438 WP_024085600.1 competence type IV pilus minor pilin ComGD Machinery gene
  HNO12_RS11925 (HNO12_11960) comGC 2509575..2509841 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  HNO12_RS11930 (HNO12_11965) comGB 2509888..2510925 (-) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  HNO12_RS11935 (HNO12_11970) comGA 2510912..2511982 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  HNO12_RS11940 (HNO12_11975) - 2512174..2513124 (-) 951 WP_014305415.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14169.15 Da        Isoelectric Point: 10.1579

>NTDB_id=391852 HNO12_RS11905 WP_003153092.1 2508063..2508440(-) (comGG) [Bacillus amyloliquefaciens strain WF02]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSNRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=391852 HNO12_RS11905 WP_003153092.1 2508063..2508440(-) (comGG) [Bacillus amyloliquefaciens strain WF02]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTAATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterProScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512


Multiple sequence alignment