Detailed information NTG0388960

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: LPB220_RS01225
• Genome accession: NZ_CP044230
• Coordinates: 211704..212021 (+)
• Length: 105 a.a.
• NCBI ID: WP_150905144.1
• Uniprot ID: A0A5J6LJX7
• Organism: Streptococcus sp. LPB0220
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 206704..217021

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LPB220_RS01210 (LPB220_01210)	-	209325..209714 (+)	390	WP_042759849.1	DUF1033 family protein	-
LPB220_RS01215 (LPB220_01215)	comYA	209802..210743 (+)	942	WP_021154281.1	competence type IV pilus ATPase ComGA	Machinery gene
LPB220_RS01220 (LPB220_01220)	comYB	210676..211707 (+)	1032	WP_176745544.1	competence type IV pilus assembly protein ComGB	Machinery gene
LPB220_RS01225 (LPB220_01225)	comYC	211704..212021 (+)	318	WP_150905144.1	competence type IV pilus major pilin ComGC	Machinery gene
LPB220_RS01230 (LPB220_01230)	comYD	212011..212415 (+)	405	WP_003004513.1	competence type IV pilus minor pilin ComGD	Machinery gene
LPB220_RS01235 (LPB220_01235)	comGE	212381..212668 (+)	288	WP_003004353.1	competence type IV pilus minor pilin ComGE	-
LPB220_RS01240 (LPB220_01240)	comGF/cglF	212658..213110 (+)	453	WP_031572613.1	competence type IV pilus minor pilin ComGF	Machinery gene
LPB220_RS01245 (LPB220_01245)	comGG	213067..213534 (+)	468	WP_225305918.1	competence type IV pilus minor pilin ComGG	-
LPB220_RS01250 (LPB220_01250)	comYH	213565..214518 (+)	954	WP_021154287.1	class I SAM-dependent methyltransferase	Machinery gene
LPB220_RS01255 (LPB220_01255)	-	214570..215763 (+)	1194	WP_150905146.1	acetate kinase	-
LPB220_RS01260 (LPB220_01260)	-	215836..216567 (+)	732	WP_150905148.1	CPBP family intramembrane glutamic endopeptidase	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11646.55 Da
• Isoelectric Point: 9.2975

>NTDB_id=388960 LPB220_RS01225 WP_150905144.1 211704..212021(+) (comYC) [Streptococcus sp. LPB0220]
MKTLKTYKVKAFTLIEMLVVLLIISVLLLLFVPNLTKQKDSVKETGNAAVVKVVESQAELYELNHTNEQATLAKLIADGN
ITNKQAESYRAYYAKNSGETRAVAD

Nucleotide

• Length: 318 bp

>NTDB_id=388960 LPB220_RS01225 WP_150905144.1 211704..212021(+) (comYC) [Streptococcus sp. LPB0220]
ATGAAAACATTAAAAACCTATAAGGTTAAAGCCTTTACACTGATTGAAATGTTGGTGGTCTTATTGATCATCAGTGTGCT
CTTATTGCTCTTTGTGCCGAATTTGACCAAGCAAAAAGACTCCGTGAAAGAGACAGGAAATGCAGCTGTAGTGAAGGTGG
TCGAAAGCCAGGCTGAATTGTACGAGCTCAATCATACCAATGAACAAGCTACTCTAGCAAAGCTGATTGCTGATGGAAAT
ATTACCAACAAACAAGCAGAGTCCTACCGTGCCTATTATGCGAAAAATAGTGGAGAAACTCGTGCGGTTGCAGATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

3D structure

• AlphaFold DB: A0A5J6LJX7

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus gordonii str. Challis substr. CH1	74.286	100	0.743
comYC	Streptococcus mutans UA159	71.429	100	0.714
comYC	Streptococcus mutans UA140	71.429	100	0.714
comGC/cglC	Streptococcus mitis SK321	70.476	100	0.705
comGC/cglC	Streptococcus mitis NCTC 12261	68.868	100	0.695
comGC/cglC	Streptococcus pneumoniae Rx1	67.619	100	0.676
comGC/cglC	Streptococcus pneumoniae R6	67.619	100	0.676
comGC/cglC	Streptococcus pneumoniae TIGR4	67.619	100	0.676
comGC/cglC	Streptococcus pneumoniae D39	67.619	100	0.676
comYC	Streptococcus suis isolate S10	67.416	84.762	0.571
comGC	Lactococcus lactis subsp. cremoris KW2	60.204	93.333	0.562
comGC	Staphylococcus aureus N315	45.918	93.333	0.429
comGC	Staphylococcus aureus MW2	45.918	93.333	0.429