Detailed information NTG0313509

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: D2E16_RS00865
• Genome accession: NZ_CP032064
• Coordinates: 144472..144753 (+)
• Length: 93 a.a.
• NCBI ID: WP_044765768.1
• Uniprot ID: A0A0Z8YBH4
• Organism: Streptococcus suis strain YSJ17
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 139472..149753

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
D2E16_RS00840 (D2E16_00870)	-	140763..140969 (-)	207	WP_002941576.1	hypothetical protein	-
D2E16_RS00845 (D2E16_00875)	tnpB	141021..141371 (-)	351	WP_002941575.1	IS66 family insertion sequence element accessory protein TnpB	-
D2E16_RS00850 (D2E16_00880)	-	141622..142485 (-)	864	Protein_133	S66 family peptidase	-
D2E16_RS00855 (D2E16_00885)	comYA	142571..143521 (+)	951	WP_100664710.1	competence type IV pilus ATPase ComGA	Machinery gene
D2E16_RS00860 (D2E16_00890)	comYB	143433..144470 (+)	1038	WP_225620794.1	competence type IV pilus assembly protein ComGB	Machinery gene
D2E16_RS00865 (D2E16_00895)	comYC	144472..144753 (+)	282	WP_044765768.1	competence type IV pilus major pilin ComGC	Machinery gene
D2E16_RS00870 (D2E16_00900)	comGD	144734..145141 (+)	408	WP_029173989.1	competence type IV pilus minor pilin ComGD	-
D2E16_RS00875 (D2E16_00905)	comYE	145113..145406 (+)	294	WP_192369520.1	competence type IV pilus minor pilin ComGE	Machinery gene
D2E16_RS00880 (D2E16_00910)	comGF/cglF	145393..145827 (+)	435	WP_044765773.1	competence type IV pilus minor pilin ComGF	Machinery gene
D2E16_RS00885 (D2E16_00915)	comGG	145805..146332 (+)	528	WP_192369521.1	competence type IV pilus minor pilin ComGG	-
D2E16_RS00890 (D2E16_00920)	comYH	146388..147341 (+)	954	WP_192369522.1	class I SAM-dependent methyltransferase	Machinery gene
D2E16_RS00895 (D2E16_00925)	-	147392..148579 (+)	1188	WP_192369523.1	acetate kinase	-
D2E16_RS00900 (D2E16_00930)	-	148839..149390 (+)	552	WP_099806699.1	folate family ECF transporter S component	-

Sequence

Protein

• Length: 93 a.a.
• Molecular weight: 10473.53 Da
• Isoelectric Point: 9.9102

>NTDB_id=313509 D2E16_RS00865 WP_044765768.1 144472..144753(+) (comYC) [Streptococcus suis strain YSJ17]
MKKLLKLKKKAFTLVEMLVVLGIISLLLLIFVPNLSKQKDAIQKKGNAAVIKVVESQMELYELEHDKEATVADLQADGYI
TEKQAEQYAKAKK

Nucleotide

• Length: 282 bp

>NTDB_id=313509 D2E16_RS00865 WP_044765768.1 144472..144753(+) (comYC) [Streptococcus suis strain YSJ17]
ATGAAAAAATTGTTGAAATTAAAAAAGAAAGCTTTCACTCTGGTGGAAATGTTAGTTGTTTTGGGTATTATTAGTCTGCT
CTTGCTCATTTTTGTGCCTAATTTGAGCAAGCAGAAGGATGCTATTCAGAAGAAGGGGAATGCGGCTGTTATCAAAGTGG
TGGAGAGTCAAATGGAACTCTATGAATTGGAACATGACAAGGAAGCTACGGTAGCAGACTTGCAAGCGGATGGCTATATT
ACTGAAAAACAAGCGGAGCAGTATGCTAAGGCGAAAAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

3D structure

• AlphaFold DB: A0A0Z8YBH4

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus suis isolate S10	86.022	100	0.86
comGC/cglC	Streptococcus pneumoniae TIGR4	64.13	98.925	0.634
comGC/cglC	Streptococcus pneumoniae Rx1	64.13	98.925	0.634
comGC/cglC	Streptococcus pneumoniae D39	64.13	98.925	0.634
comGC/cglC	Streptococcus pneumoniae R6	64.13	98.925	0.634
comGC/cglC	Streptococcus mitis NCTC 12261	64.13	98.925	0.634
comGC/cglC	Streptococcus mitis SK321	64.13	98.925	0.634
comYC	Streptococcus gordonii str. Challis substr. CH1	64.045	95.699	0.613
comYC	Streptococcus mutans UA140	59.091	94.624	0.559
comYC	Streptococcus mutans UA159	59.091	94.624	0.559
comGC	Lactococcus lactis subsp. cremoris KW2	56.818	94.624	0.538
comGC	Staphylococcus aureus MW2	51.765	91.398	0.473
comGC	Staphylococcus aureus N315	51.765	91.398	0.473
comGC	Bacillus subtilis subsp. subtilis str. 168	49.333	80.645	0.398
comGC	Latilactobacillus sakei subsp. sakei 23K	42.5	86.022	0.366