Detailed information NTG0313511

Bioinformatically predicted

Overview

• Name: comGF/cglF
• Type: Machinery gene
• Locus tag: D2E16_RS00880
• Genome accession: NZ_CP032064
• Coordinates: 145393..145827 (+)
• Length: 144 a.a.
• NCBI ID: WP_044765773.1
• Uniprot ID: -
• Organism: Streptococcus suis strain YSJ17
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 140393..150827

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
D2E16_RS00840 (D2E16_00870)	-	140763..140969 (-)	207	WP_002941576.1	hypothetical protein	-
D2E16_RS00845 (D2E16_00875)	tnpB	141021..141371 (-)	351	WP_002941575.1	IS66 family insertion sequence element accessory protein TnpB	-
D2E16_RS00850 (D2E16_00880)	-	141622..142485 (-)	864	Protein_133	S66 family peptidase	-
D2E16_RS00855 (D2E16_00885)	comYA	142571..143521 (+)	951	WP_100664710.1	competence type IV pilus ATPase ComGA	Machinery gene
D2E16_RS00860 (D2E16_00890)	comYB	143433..144470 (+)	1038	WP_225620794.1	competence type IV pilus assembly protein ComGB	Machinery gene
D2E16_RS00865 (D2E16_00895)	comYC	144472..144753 (+)	282	WP_044765768.1	competence type IV pilus major pilin ComGC	Machinery gene
D2E16_RS00870 (D2E16_00900)	comGD	144734..145141 (+)	408	WP_029173989.1	competence type IV pilus minor pilin ComGD	-
D2E16_RS00875 (D2E16_00905)	comYE	145113..145406 (+)	294	WP_192369520.1	competence type IV pilus minor pilin ComGE	Machinery gene
D2E16_RS00880 (D2E16_00910)	comGF/cglF	145393..145827 (+)	435	WP_044765773.1	competence type IV pilus minor pilin ComGF	Machinery gene
D2E16_RS00885 (D2E16_00915)	comGG	145805..146332 (+)	528	WP_192369521.1	competence type IV pilus minor pilin ComGG	-
D2E16_RS00890 (D2E16_00920)	comYH	146388..147341 (+)	954	WP_192369522.1	class I SAM-dependent methyltransferase	Machinery gene
D2E16_RS00895 (D2E16_00925)	-	147392..148579 (+)	1188	WP_192369523.1	acetate kinase	-
D2E16_RS00900 (D2E16_00930)	-	148839..149390 (+)	552	WP_099806699.1	folate family ECF transporter S component	-
D2E16_RS00905 (D2E16_00935)	-	149444..150700 (+)	1257	WP_192369524.1	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	-

Sequence

Protein

• Length: 144 a.a.
• Molecular weight: 16503.86 Da
• Isoelectric Point: 6.9825

>NTDB_id=313511 D2E16_RS00880 WP_044765773.1 145393..145827(+) (comGF/cglF) [Streptococcus suis strain YSJ17]
MLKNKIPAFTLLECLVALVILSGSLLVFEGLSKLLVQEAHYQNQTIQKEWLVFSSQLRSEWDQADLVKVENGKVYVNKGE
QALAFGKSRSDDFRKTNDKGQGYQPMIYQVDSVAISQENQLVRIDFSFKNGEERTFIYAFKEKS

Nucleotide

• Length: 435 bp

>NTDB_id=313511 D2E16_RS00880 WP_044765773.1 145393..145827(+) (comGF/cglF) [Streptococcus suis strain YSJ17]
TTGTTAAAAAATAAAATTCCTGCTTTTACACTCTTGGAATGCTTGGTAGCCTTAGTCATCCTATCAGGAAGTCTTCTGGT
CTTTGAAGGCTTGTCAAAACTGCTAGTCCAAGAAGCGCATTATCAAAATCAAACTATTCAAAAGGAGTGGCTGGTCTTTT
CTAGTCAGTTGCGGTCAGAGTGGGACCAAGCAGACTTGGTCAAGGTTGAAAATGGCAAGGTCTATGTCAACAAAGGCGAA
CAGGCTTTGGCCTTTGGCAAGTCACGGTCGGATGATTTTCGGAAAACCAATGATAAGGGACAGGGCTACCAGCCTATGAT
TTATCAGGTGGACAGCGTAGCTATTTCCCAAGAAAACCAGCTAGTGCGCATCGACTTTAGCTTTAAAAACGGGGAGGAGC
GGACCTTTATCTATGCTTTTAAAGAAAAAAGTTAA

Domains

Predicted by InterproScan.

• Putative Competence protein ComGF (ComGF) (37-134)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGF/cglF	Streptococcus pneumoniae Rx1	52.817	98.611	0.521
comGF/cglF	Streptococcus pneumoniae D39	52.817	98.611	0.521
comGF/cglF	Streptococcus pneumoniae R6	52.817	98.611	0.521
comGF/cglF	Streptococcus pneumoniae TIGR4	52.817	98.611	0.521
comGF/cglF	Streptococcus mitis NCTC 12261	52.593	93.75	0.493
comYF	Streptococcus mutans UA140	47.917	100	0.479
comYF	Streptococcus mutans UA159	47.222	100	0.472
comGF/cglF	Streptococcus mitis SK321	49.63	93.75	0.465
comGF	Lactococcus lactis subsp. cremoris KW2	46.099	97.917	0.451