Detailed information NTG0257591

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: CWI26_RS00820
• Genome accession: NZ_CP025043
• Coordinates: 135408..135689 (+)
• Length: 93 a.a.
• NCBI ID: WP_044760307.1
• Uniprot ID: A0A0Z8JGS7
• Organism: Streptococcus suis strain AH681
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 130408..140689

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
CWI26_RS00795 (CWI26_00795)	-	130432..131688 (-)	1257	WP_100881034.1	ISL3 family transposase	-
CWI26_RS00800 (CWI26_00800)	-	131967..132326 (+)	360	WP_044776736.1	DUF1033 family protein	-
CWI26_RS00805 (CWI26_00805)	-	132471..133421 (-)	951	WP_100881035.1	S66 family peptidase	-
CWI26_RS00810 (CWI26_00810)	comYA	133507..134457 (+)	951	WP_044760311.1	competence type IV pilus ATPase ComGA	Machinery gene
CWI26_RS00815 (CWI26_00815)	comYB	134369..135406 (+)	1038	WP_233486262.1	competence type IV pilus assembly protein ComGB	Machinery gene
CWI26_RS00820 (CWI26_00820)	comYC	135408..135689 (+)	282	WP_044760307.1	competence type IV pilus major pilin ComGC	Machinery gene
CWI26_RS00825 (CWI26_00825)	comGD	135670..136077 (+)	408	WP_100881037.1	competence type IV pilus minor pilin ComGD	-
CWI26_RS00830 (CWI26_00830)	comYE	136049..136342 (+)	294	WP_100881038.1	competence type IV pilus minor pilin ComGE	Machinery gene
CWI26_RS00835 (CWI26_00835)	comGF/cglF	136329..136763 (+)	435	WP_100881039.1	competence type IV pilus minor pilin ComGF	Machinery gene
CWI26_RS00840 (CWI26_00840)	comGG	136741..137268 (+)	528	WP_029180264.1	competence type IV pilus minor pilin ComGG	-
CWI26_RS00845 (CWI26_00845)	comYH	137325..138278 (+)	954	WP_100881040.1	class I SAM-dependent methyltransferase	Machinery gene
CWI26_RS00850 (CWI26_00850)	-	138328..139515 (+)	1188	WP_100881041.1	acetate kinase	-
CWI26_RS00860 (CWI26_00860)	-	139829..140380 (+)	552	WP_100881043.1	folate family ECF transporter S component	-

Sequence

Protein

• Length: 93 a.a.
• Molecular weight: 10463.42 Da
• Isoelectric Point: 7.0117

>NTDB_id=257591 CWI26_RS00820 WP_044760307.1 135408..135689(+) (comYC) [Streptococcus suis strain AH681]
MKKLIEMKVKAFTLVEMLVVLGIISLLLLIFVPNLSQQKDAIQKKGNAAVIKVVESQMELYELEHDKEATVADLQADGYI
TEKQAEQYAKAKK

Nucleotide

• Length: 282 bp

>NTDB_id=257591 CWI26_RS00820 WP_044760307.1 135408..135689(+) (comYC) [Streptococcus suis strain AH681]
ATGAAAAAATTAATTGAAATGAAGGTAAAAGCGTTCACTCTGGTGGAAATGTTAGTTGTTTTGGGTATTATTAGCCTGCT
CTTGCTCATTTTTGTGCCAAATTTGAGCCAGCAGAAGGATGCTATTCAGAAGAAGGGGAATGCGGCTGTTATCAAAGTGG
TGGAGAGTCAAATGGAACTCTATGAATTGGAACATGACAAGGAAGCAACGGTGGCAGACTTGCAAGCGGATGGCTATATT
ACTGAAAAACAAGCGGAGCAGTATGCTAAGGCGAAAAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

3D structure

• AlphaFold DB: A0A0Z8JGS7

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus suis isolate S10	90.323	100	0.903
comGC/cglC	Streptococcus pneumoniae TIGR4	63.043	98.925	0.624
comGC/cglC	Streptococcus pneumoniae Rx1	63.043	98.925	0.624
comGC/cglC	Streptococcus pneumoniae D39	63.043	98.925	0.624
comGC/cglC	Streptococcus pneumoniae R6	63.043	98.925	0.624
comGC/cglC	Streptococcus mitis NCTC 12261	63.043	98.925	0.624
comGC/cglC	Streptococcus mitis SK321	63.043	98.925	0.624
comYC	Streptococcus gordonii str. Challis substr. CH1	61.798	95.699	0.591
comYC	Streptococcus mutans UA140	59.091	94.624	0.559
comYC	Streptococcus mutans UA159	59.091	94.624	0.559
comGC	Lactococcus lactis subsp. cremoris KW2	55.682	94.624	0.527
comGC	Staphylococcus aureus MW2	50	83.871	0.419
comGC	Staphylococcus aureus N315	50	83.871	0.419
comGC	Bacillus subtilis subsp. subtilis str. 168	49.333	80.645	0.398