Detailed information NTG0178275

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: V471_RS01990
• Genome accession: NZ_CP015283
• Coordinates: 393834..394148 (-)
• Length: 104 a.a.
• NCBI ID: WP_037611125.1
• Uniprot ID: -
• Organism: Streptococcus salivarius strain ATCC 25975
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 388834..399148

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
V471_RS01950 (V471_01955)	-	389098..389754 (-)	657	WP_084871056.1	CPBP family intramembrane glutamic endopeptidase	-
V471_RS01955 (V471_01960)	-	389766..389963 (-)	198	WP_002885716.1	helix-turn-helix transcriptional regulator	-
V471_RS01960 (V471_01965)	-	390214..391407 (-)	1194	WP_003095894.1	acetate kinase	-
V471_RS01965 (V471_01970)	comYH	391464..392420 (-)	957	WP_037601477.1	class I SAM-dependent methyltransferase	Machinery gene
V471_RS01970 (V471_01975)	comGG	392465..392782 (-)	318	WP_037601475.1	competence type IV pilus minor pilin ComGG	-
V471_RS01975 (V471_01980)	comYF	392760..393197 (-)	438	WP_037601472.1	competence type IV pilus minor pilin ComGF	Machinery gene
V471_RS01980 (V471_01985)	comGE	393184..393414 (-)	231	WP_084871057.1	competence type IV pilus minor pilin ComGE	-
V471_RS01985 (V471_01990)	comYD	393446..393874 (-)	429	WP_014632541.1	competence type IV pilus minor pilin ComGD	Machinery gene
V471_RS01990 (V471_01995)	comYC	393834..394148 (-)	315	WP_037611125.1	competence type IV pilus major pilin ComGC	Machinery gene
V471_RS01995 (V471_02000)	comYB	394157..395257 (-)	1101	WP_138261574.1	competence type IV pilus assembly protein ComGB	Machinery gene
V471_RS02000 (V471_02005)	comGA/cglA/cilD	395139..396080 (-)	942	WP_002887018.1	competence type IV pilus ATPase ComGA	Machinery gene
V471_RS02005 (V471_02010)	-	396114..397592 (-)	1479	WP_084871058.1	IS1182 family transposase	-
V471_RS02010 (V471_02015)	-	397722..398084 (-)	363	WP_049529260.1	DUF1033 family protein	-

Sequence

Protein

• Length: 104 a.a.
• Molecular weight: 11428.31 Da
• Isoelectric Point: 9.7150

>NTDB_id=178275 V471_RS01990 WP_037611125.1 393834..394148(-) (comYC) [Streptococcus salivarius strain ATCC 25975]
MKKLNAVKLRAFTLIEMLVVLLIISILLLLFVPNLSKQKDSVKETGNAAVVKVVDSQAELYEMKNNKTASLAALVSEGQI
TQKQADSYNDYYAKHGGESRSVAN

Nucleotide

• Length: 315 bp

>NTDB_id=178275 V471_RS01990 WP_037611125.1 393834..394148(-) (comYC) [Streptococcus salivarius strain ATCC 25975]
TTGAAAAAATTGAATGCCGTTAAACTACGAGCTTTTACACTGATTGAAATGCTGGTCGTGCTTCTCATTATCAGTATTCT
CCTTTTGCTCTTTGTACCTAACTTGAGCAAGCAGAAGGATTCTGTTAAAGAGACTGGAAATGCGGCTGTGGTCAAGGTCG
TGGATTCTCAAGCAGAACTTTATGAAATGAAGAATAATAAGACAGCTAGCTTAGCTGCTCTTGTTTCAGAAGGTCAAATC
ACGCAAAAACAGGCAGATTCATACAATGATTATTATGCGAAACATGGTGGCGAAAGCCGCTCAGTGGCCAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (10-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus mutans UA140	70.192	100	0.702
comYC	Streptococcus mutans UA159	70.192	100	0.702
comYC	Streptococcus gordonii str. Challis substr. CH1	64.762	100	0.654
comGC/cglC	Streptococcus mitis SK321	63.636	95.192	0.606
comGC/cglC	Streptococcus mitis NCTC 12261	59.406	97.115	0.577
comGC	Lactococcus lactis subsp. cremoris KW2	58.416	97.115	0.567
comGC/cglC	Streptococcus pneumoniae R6	59.596	95.192	0.567
comGC/cglC	Streptococcus pneumoniae Rx1	59.596	95.192	0.567
comGC/cglC	Streptococcus pneumoniae TIGR4	59.596	95.192	0.567
comGC/cglC	Streptococcus pneumoniae D39	59.596	95.192	0.567
comYC	Streptococcus suis isolate S10	61.364	84.615	0.519
comGC	Staphylococcus aureus MW2	50	75	0.375
comGC	Staphylococcus aureus N315	50	75	0.375