Detailed information NTG1132025

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: H1W80_RS08450
• Genome accession: NZ_LR822040
• Coordinates: 1632906..1633232 (-)
• Length: 108 a.a.
• NCBI ID: WP_002946126.1
• Uniprot ID: A0A0E2Q1B3
• Organism: Streptococcus thermophilus isolate STH_CIRM_1125
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1627906..1638232

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
H1W80_RS09720 (STHERMO_1898)	-	1628172..1628597 (-)	426	WP_232086518.1	CPBP family intramembrane glutamic endopeptidase	-
H1W80_RS09725 (STHERMO_1899)	-	1628554..1628829 (-)	276	WP_232086519.1	CAAX protease	-
H1W80_RS08415 (STHERMO_1900)	-	1628841..1629038 (-)	198	WP_002885716.1	helix-turn-helix transcriptional regulator	-
H1W80_RS08420 (STHERMO_1901)	-	1629287..1630480 (-)	1194	WP_180473352.1	acetate kinase	-
H1W80_RS08425 (STHERMO_1902)	comYH	1630536..1631492 (-)	957	WP_011226622.1	class I SAM-dependent methyltransferase	Machinery gene
H1W80_RS08430 (STHERMO_1903)	comGG	1631537..1631854 (-)	318	WP_002952035.1	competence type IV pilus minor pilin ComGG	-
H1W80_RS08435 (STHERMO_1904)	comYF	1631832..1632269 (-)	438	WP_082309153.1	competence type IV pilus minor pilin ComGF	Machinery gene
H1W80_RS08440 (STHERMO_1905)	comGE	1632253..1632546 (-)	294	WP_180473353.1	competence type IV pilus minor pilin ComGE	-
H1W80_RS08445 (STHERMO_1906)	comYD	1632518..1632946 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
H1W80_RS08450 (STHERMO_1907)	comYC	1632906..1633232 (-)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
H1W80_RS08455 (STHERMO_1908)	comYB	1633229..1634329 (-)	1101	WP_180473354.1	competence type IV pilus assembly protein ComGB	Machinery gene
H1W80_RS08460 (STHERMO_1909)	comGA/cglA/cilD	1634211..1635152 (-)	942	WP_022096896.1	competence type IV pilus ATPase ComGA	Machinery gene
H1W80_RS08465 (STHERMO_1910)	-	1635233..1635595 (-)	363	WP_014608746.1	DUF1033 family protein	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 11914.00 Da
• Isoelectric Point: 9.9219

>NTDB_id=1132025 H1W80_RS08450 WP_002946126.1 1632906..1633232(-) (comYC) [Streptococcus thermophilus isolate STH_CIRM_1125]
MKLMLKKLNAVKLRAFTLIEMLVVLLIISILLLLFVPNLSKQKDSVKETGNAAVVKVVDSQAELYEMKNNKTASLAALVS
EGQITQKQADSYNDYYAKHGGESRSVAN

Nucleotide

• Length: 327 bp

>NTDB_id=1132025 H1W80_RS08450 WP_002946126.1 1632906..1633232(-) (comYC) [Streptococcus thermophilus isolate STH_CIRM_1125]
ATGAAATTGATGTTAAAAAAATTGAATGCCGTTAAATTACGAGCCTTTACTCTGATTGAAATGCTAGTCGTACTTCTCAT
TATCAGTATTCTCCTTTTGCTCTTTGTTCCTAACTTAAGCAAGCAGAAGGATTCCGTTAAGGAAACTGGAAATGCGGCTG
TAGTCAAGGTCGTGGATTCTCAGGCAGAACTTTATGAAATGAAGAATAACAAGACAGCTAGCTTGGCAGCTCTTGTTTCA
GAAGGTCAAATTACGCAAAAACAGGCAGATTCATATAATGATTACTATGCGAAACATGGTGGTGAAAGCCGCTCAGTGGC
CAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (14-34)

3D structure

• AlphaFold DB: A0A0E2Q1B3

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus mutans UA140	69.231	96.296	0.667
comYC	Streptococcus mutans UA159	69.231	96.296	0.667
comYC	Streptococcus gordonii str. Challis substr. CH1	63.81	97.222	0.62
comGC/cglC	Streptococcus mitis SK321	62.264	98.148	0.611
comGC/cglC	Streptococcus mitis NCTC 12261	58.333	100	0.583
comGC/cglC	Streptococcus pneumoniae D39	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae R6	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae Rx1	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae TIGR4	58.491	98.148	0.574
comGC	Lactococcus lactis subsp. cremoris KW2	56.604	98.148	0.556
comYC	Streptococcus suis isolate S10	60.227	81.481	0.491
comGC	Staphylococcus aureus MW2	50	72.222	0.361
comGC	Staphylococcus aureus N315	50	72.222	0.361