Detailed information NTG1129582

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: GPW69_RS00755
• Genome accession: NZ_LR738724
• Coordinates: 115930..116211 (+)
• Length: 93 a.a.
• NCBI ID: WP_074391328.1
• Uniprot ID: -
• Organism: Streptococcus suis isolate 9401240
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 110930..121211

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
GPW69_RS00735	-	112591..112965 (+)	375	WP_024385120.1	DUF1033 family protein	-
GPW69_RS00740	-	112993..113943 (-)	951	WP_074391326.1	S66 peptidase family protein	-
GPW69_RS00745	comYA	114029..114979 (+)	951	WP_074391327.1	competence type IV pilus ATPase ComGA	Machinery gene
GPW69_RS00750	comYB	114891..115928 (+)	1038	WP_269472402.1	competence type IV pilus assembly protein ComGB	Machinery gene
GPW69_RS00755	comYC	115930..116211 (+)	282	WP_074391328.1	competence type IV pilus major pilin ComGC	Machinery gene
GPW69_RS00760	comGD	116192..116599 (+)	408	WP_074391329.1	competence type IV pilus minor pilin ComGD	-
GPW69_RS00765	comYE	116571..116864 (+)	294	WP_024401507.1	competence type IV pilus minor pilin ComGE	Machinery gene
GPW69_RS00770	comGF/cglF	116851..117285 (+)	435	WP_044762030.1	competence type IV pilus minor pilin ComGF	Machinery gene
GPW69_RS00775	comGG	117263..117676 (+)	414	WP_074391330.1	competence type IV pilus minor pilin ComGG	-
GPW69_RS00780	comYH	117726..118679 (+)	954	WP_024414316.1	class I SAM-dependent methyltransferase	Machinery gene
GPW69_RS00785	-	118729..119916 (+)	1188	WP_044680792.1	acetate kinase	-
GPW69_RS00790	-	120233..120784 (+)	552	WP_074391332.1	folate family ECF transporter S component	-

Sequence

Protein

• Length: 93 a.a.
• Molecular weight: 10474.48 Da
• Isoelectric Point: 8.3596

>NTDB_id=1129582 GPW69_RS00755 WP_074391328.1 115930..116211(+) (comYC) [Streptococcus suis isolate 9401240]
MKKLIEMKVKGFTLVEMLVVLGIISLLLLLFVPNLSKQKDAIQKKGDAAVVKVVESQMELYELEYDKEATVEDLQKAGYI
TPKQAEQYATAKK

Nucleotide

• Length: 282 bp

>NTDB_id=1129582 GPW69_RS00755 WP_074391328.1 115930..116211(+) (comYC) [Streptococcus suis isolate 9401240]
ATGAAAAAATTAATTGAAATGAAGGTAAAAGGGTTCACTCTGGTGGAAATGTTAGTCGTTTTGGGAATTATCAGCCTGCT
CTTGCTCCTCTTTGTGCCAAATTTGAGCAAGCAGAAGGATGCTATTCAGAAGAAGGGGGATGCTGCGGTTGTCAAAGTAG
TGGAGAGTCAGATGGAGCTCTATGAATTGGAATATGATAAGGAAGCAACGGTGGAGGACTTGCAAAAGGCTGGTTATATT
ACGCCAAAACAAGCGGAGCAGTATGCTACGGCGAAAAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus suis isolate S10	90.323	100	0.903
comGC/cglC	Streptococcus pneumoniae Rx1	61.957	98.925	0.613
comGC/cglC	Streptococcus pneumoniae D39	61.957	98.925	0.613
comGC/cglC	Streptococcus pneumoniae R6	61.957	98.925	0.613
comGC/cglC	Streptococcus pneumoniae TIGR4	61.957	98.925	0.613
comGC/cglC	Streptococcus mitis NCTC 12261	61.957	98.925	0.613
comGC/cglC	Streptococcus mitis SK321	61.957	98.925	0.613
comYC	Streptococcus gordonii str. Challis substr. CH1	62.921	95.699	0.602
comYC	Streptococcus mutans UA140	60.227	94.624	0.57
comYC	Streptococcus mutans UA159	60.227	94.624	0.57
comGC	Lactococcus lactis subsp. cremoris KW2	57.955	94.624	0.548
comGC	Staphylococcus aureus MW2	48.718	83.871	0.409
comGC	Staphylococcus aureus N315	48.718	83.871	0.409
comGC	Bacillus subtilis subsp. subtilis str. 168	48	80.645	0.387