Detailed information NTG1111720

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: HMPREF9425_RS00685
• Genome accession: NZ_GL831112
• Coordinates: 133900..134226 (+)
• Length: 108 a.a.
• NCBI ID: WP_002885815.1
• Uniprot ID: -
• Organism: Streptococcus vestibularis ATCC 49124
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 128900..139226

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
HMPREF9425_RS00670 (HMPREF9425_0138)	-	131537..131899 (+)	363	WP_003095881.1	DUF1033 family protein	-
HMPREF9425_RS00675 (HMPREF9425_0139)	comYA	131980..132921 (+)	942	WP_003095883.1	competence type IV pilus ATPase ComGA	Machinery gene
HMPREF9425_RS00680 (HMPREF9425_0140)	comYB	132803..133903 (+)	1101	WP_155809878.1	competence type IV pilus assembly protein ComGB	Machinery gene
HMPREF9425_RS00685 (HMPREF9425_0141)	comYC	133900..134226 (+)	327	WP_002885815.1	competence type IV pilus major pilin ComGC	Machinery gene
HMPREF9425_RS00690 (HMPREF9425_0142)	comYD	134186..134614 (+)	429	WP_253665936.1	competence type IV pilus minor pilin ComGD	Machinery gene
HMPREF9425_RS00695 (HMPREF9425_0143)	comGE	134646..134876 (+)	231	WP_003095891.1	competence type IV pilus minor pilin ComGE	-
HMPREF9425_RS00700 (HMPREF9425_0144)	comYF	134863..135300 (+)	438	WP_003091908.1	competence type IV pilus minor pilin ComGF	Machinery gene
HMPREF9425_RS00705 (HMPREF9425_0145)	comGG	135278..135595 (+)	318	WP_003092009.1	competence type IV pilus minor pilin ComGG	-
HMPREF9425_RS00710 (HMPREF9425_0146)	comYH	135640..136596 (+)	957	WP_003091902.1	class I SAM-dependent methyltransferase	Machinery gene
HMPREF9425_RS00715 (HMPREF9425_0147)	-	136653..137846 (+)	1194	WP_003095894.1	acetate kinase	-
HMPREF9425_RS00720 (HMPREF9425_0148)	-	138097..138294 (+)	198	WP_002885716.1	helix-turn-helix transcriptional regulator	-
HMPREF9425_RS00725 (HMPREF9425_0149)	-	138308..138751 (+)	444	WP_037621248.1	hypothetical protein	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 11932.03 Da
• Isoelectric Point: 9.9219

>NTDB_id=1111720 HMPREF9425_RS00685 WP_002885815.1 133900..134226(+) (comYC) [Streptococcus vestibularis ATCC 49124]
MKMMLKKLNAVKLRAFTLIEMLVVLLIISILLLLFVPNLSKQKDSVKETGNAAVVKVVDSQAELYEMKNNKTASLAALVS
EGQITQKQADSYNDYYAKHGGESRSVAN

Nucleotide

• Length: 327 bp

>NTDB_id=1111720 HMPREF9425_RS00685 WP_002885815.1 133900..134226(+) (comYC) [Streptococcus vestibularis ATCC 49124]
ATGAAAATGATGTTAAAAAAATTGAATGCCGTTAAACTACGAGCTTTTACACTGATTGAAATGTTGGTCGTGCTTCTCAT
TATCAGTATTCTCCTTTTGCTCTTTGTACCTAACTTGAGCAAGCAGAAGGATTCTGTTAAAGAGACTGGAAATGCGGCTG
TGGTCAAGGTCGTGGATTCTCAAGCAGAACTTTATGAAATGAAGAATAACAAGACAGCTAGCTTAGCCGCTCTTGTTTCA
GAAGGTCAAATCACGCAAAAACAGGCAGATTCATACAATGATTATTATGCGAAACATGGTGGCGAAAGCCGCTCAGTGGC
CAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (14-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus mutans UA140	69.231	96.296	0.667
comYC	Streptococcus mutans UA159	69.231	96.296	0.667
comYC	Streptococcus gordonii str. Challis substr. CH1	63.81	97.222	0.62
comGC/cglC	Streptococcus mitis SK321	62.264	98.148	0.611
comGC/cglC	Streptococcus mitis NCTC 12261	58.333	100	0.583
comGC/cglC	Streptococcus pneumoniae D39	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae R6	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae Rx1	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae TIGR4	58.491	98.148	0.574
comGC	Lactococcus lactis subsp. cremoris KW2	56.604	98.148	0.556
comYC	Streptococcus suis isolate S10	60.227	81.481	0.491
comGC	Staphylococcus aureus MW2	50	72.222	0.361
comGC	Staphylococcus aureus N315	50	72.222	0.361