Detailed information NTG1111721

Bioinformatically predicted

Overview

• Name: comYD
• Type: Machinery gene
• Locus tag: HMPREF9425_RS00690
• Genome accession: NZ_GL831112
• Coordinates: 134186..134614 (+)
• Length: 142 a.a.
• NCBI ID: WP_253665936.1
• Uniprot ID: -
• Organism: Streptococcus vestibularis ATCC 49124
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 129186..139614

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
HMPREF9425_RS00670 (HMPREF9425_0138)	-	131537..131899 (+)	363	WP_003095881.1	DUF1033 family protein	-
HMPREF9425_RS00675 (HMPREF9425_0139)	comYA	131980..132921 (+)	942	WP_003095883.1	competence type IV pilus ATPase ComGA	Machinery gene
HMPREF9425_RS00680 (HMPREF9425_0140)	comYB	132803..133903 (+)	1101	WP_155809878.1	competence type IV pilus assembly protein ComGB	Machinery gene
HMPREF9425_RS00685 (HMPREF9425_0141)	comYC	133900..134226 (+)	327	WP_002885815.1	competence type IV pilus major pilin ComGC	Machinery gene
HMPREF9425_RS00690 (HMPREF9425_0142)	comYD	134186..134614 (+)	429	WP_253665936.1	competence type IV pilus minor pilin ComGD	Machinery gene
HMPREF9425_RS00695 (HMPREF9425_0143)	comGE	134646..134876 (+)	231	WP_003095891.1	competence type IV pilus minor pilin ComGE	-
HMPREF9425_RS00700 (HMPREF9425_0144)	comYF	134863..135300 (+)	438	WP_003091908.1	competence type IV pilus minor pilin ComGF	Machinery gene
HMPREF9425_RS00705 (HMPREF9425_0145)	comGG	135278..135595 (+)	318	WP_003092009.1	competence type IV pilus minor pilin ComGG	-
HMPREF9425_RS00710 (HMPREF9425_0146)	comYH	135640..136596 (+)	957	WP_003091902.1	class I SAM-dependent methyltransferase	Machinery gene
HMPREF9425_RS00715 (HMPREF9425_0147)	-	136653..137846 (+)	1194	WP_003095894.1	acetate kinase	-
HMPREF9425_RS00720 (HMPREF9425_0148)	-	138097..138294 (+)	198	WP_002885716.1	helix-turn-helix transcriptional regulator	-
HMPREF9425_RS00725 (HMPREF9425_0149)	-	138308..138751 (+)	444	WP_037621248.1	hypothetical protein	-
HMPREF9425_RS00730 (HMPREF9425_0150)	-	138851..139513 (+)	663	WP_003095899.1	CPBP family intramembrane glutamic endopeptidase	-

Sequence

Protein

• Length: 142 a.a.
• Molecular weight: 15725.26 Da
• Isoelectric Point: 10.6105

>NTDB_id=1111721 HMPREF9425_RS00690 WP_253665936.1 134186..134614(+) (comYD) [Streptococcus vestibularis ATCC 49124]
MRNMVAKAAQWPIRAFTLLESLVTLAVVAFLTLSLSGSVTGIFQQVETNLFYLRFEYLYRDSQRLAAAKGANVELQLTKD
KISNGKSSLVIPKNIHLDKGQTLVFNAKGGNSSLTKIRFSSDKEVVTYQLNMGSGKYKKTVS

Nucleotide

• Length: 429 bp

>NTDB_id=1111721 HMPREF9425_RS00690 WP_253665936.1 134186..134614(+) (comYD) [Streptococcus vestibularis ATCC 49124]
ATGCGAAACATGGTGGCGAAAGCCGCTCAGTGGCCAATTAGAGCCTTTACCTTGTTGGAGAGTCTGGTGACTCTAGCAGT
GGTTGCCTTTCTCACTCTGAGTTTGTCAGGCTCAGTCACAGGTATTTTTCAGCAGGTTGAGACTAATCTTTTTTATCTGC
GCTTTGAGTACCTATACCGAGATAGTCAGCGATTGGCAGCGGCGAAAGGGGCCAATGTTGAATTGCAGTTGACCAAGGAT
AAAATCAGTAACGGAAAATCCAGTCTGGTGATTCCTAAAAATATTCATCTGGATAAGGGGCAGACGCTAGTGTTTAATGC
CAAAGGAGGCAACTCGAGCCTCACCAAGATTCGTTTTTCAAGTGATAAGGAGGTGGTGACCTATCAGCTTAACATGGGCA
GCGGTAAATATAAAAAGACGGTCTCTTAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYD	Streptococcus mutans UA140	54.198	92.254	0.5
comYD	Streptococcus mutans UA159	54.198	92.254	0.5
comYD	Streptococcus gordonii str. Challis substr. CH1	41.429	98.592	0.408
comGD/cglD	Streptococcus pneumoniae Rx1	44.882	89.437	0.401
comGD/cglD	Streptococcus pneumoniae D39	44.882	89.437	0.401
comGD/cglD	Streptococcus pneumoniae R6	44.882	89.437	0.401
comGD/cglD	Streptococcus mitis NCTC 12261	44.882	89.437	0.401
comGD/cglD	Streptococcus mitis SK321	44.094	89.437	0.394
comGD/cglD	Streptococcus pneumoniae TIGR4	44.094	89.437	0.394
comGD	Lactococcus lactis subsp. cremoris KW2	40.152	92.958	0.373