Detailed information NTG1086039

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: ACJWMD_RS09575
• Genome accession: NZ_CP177182
• Coordinates: 2007426..2007740 (-)
• Length: 104 a.a.
• NCBI ID: WP_170314557.1
• Uniprot ID: -
• Organism: Streptococcus salivarius strain MRD6060
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2002426..2012740

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACJWMD_RS09535	-	2002690..2003346 (-)	657	WP_002887011.1	CPBP family intramembrane glutamic endopeptidase	-
ACJWMD_RS09540	-	2003358..2003555 (-)	198	WP_002885716.1	helix-turn-helix transcriptional regulator	-
ACJWMD_RS09545	-	2003806..2004999 (-)	1194	WP_002885831.1	acetate kinase	-
ACJWMD_RS09550	comYH	2005056..2006012 (-)	957	WP_002887012.1	class I SAM-dependent methyltransferase	Machinery gene
ACJWMD_RS09555	comGG	2006057..2006374 (-)	318	WP_002887013.1	competence type IV pilus minor pilin ComGG	-
ACJWMD_RS09560	comYF	2006352..2006789 (-)	438	WP_002887014.1	competence type IV pilus minor pilin ComGF	Machinery gene
ACJWMD_RS09565	comGE	2006776..2007006 (-)	231	WP_002887015.1	competence type IV pilus minor pilin ComGE	-
ACJWMD_RS09570	comYD	2007038..2007466 (-)	429	WP_254593949.1	competence type IV pilus minor pilin ComGD	Machinery gene
ACJWMD_RS09575	comYC	2007426..2007740 (-)	315	WP_170314557.1	competence type IV pilus major pilin ComGC	Machinery gene
ACJWMD_RS09580	comYB	2007749..2008849 (-)	1101	WP_139053029.1	competence type IV pilus assembly protein ComGB	Machinery gene
ACJWMD_RS09585	comGA/cglA/cilD	2008731..2009672 (-)	942	WP_002887018.1	competence type IV pilus ATPase ComGA	Machinery gene
ACJWMD_RS09590	-	2009751..2010113 (-)	363	WP_002887019.1	DUF1033 family protein	-

Sequence

Protein

• Length: 104 a.a.
• Molecular weight: 11442.38 Da
• Isoelectric Point: 9.9219

>NTDB_id=1086039 ACJWMD_RS09575 WP_170314557.1 2007426..2007740(-) (comYC) [Streptococcus salivarius strain MRD6060]
MKKLKAVKLRAFTLIEMLVVLLIISILLLLFVPNLSKQKDSVKETGNAAVVKVVDSQAELYEMKNNKTASLAALVSEGQI
TQKQADSYNDYYAKHGGESRSVAN

Nucleotide

• Length: 315 bp

>NTDB_id=1086039 ACJWMD_RS09575 WP_170314557.1 2007426..2007740(-) (comYC) [Streptococcus salivarius strain MRD6060]
TTGAAAAAATTGAAGGCCGTTAAATTACGTGCTTTTACGCTGATTGAAATGCTGGTCGTGCTTCTCATTATCAGTATTCT
CCTTTTGCTCTTTGTACCTAACTTGAGCAAGCAGAAGGATTCTGTTAAAGAGACTGGAAATGCGGCTGTGGTCAAGGTCG
TGGATTCTCAAGCAGAACTTTATGAAATGAAGAATAACAAGACAGCTAGCTTAGCCGCTCTTGTTTCAGAAGGTCAAATC
ACGCAAAAACAGGCAGATTCATACAATGATTACTATGCGAAACATGGTGGCGAAAGCCGTTCAGTGGCCAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (10-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus mutans UA140	71.154	100	0.712
comYC	Streptococcus mutans UA159	71.154	100	0.712
comYC	Streptococcus gordonii str. Challis substr. CH1	65.714	100	0.663
comGC/cglC	Streptococcus mitis SK321	64.646	95.192	0.615
comGC/cglC	Streptococcus pneumoniae TIGR4	59.804	98.077	0.587
comGC/cglC	Streptococcus pneumoniae D39	59.804	98.077	0.587
comGC/cglC	Streptococcus pneumoniae Rx1	59.804	98.077	0.587
comGC/cglC	Streptococcus pneumoniae R6	59.804	98.077	0.587
comGC/cglC	Streptococcus mitis NCTC 12261	60.396	97.115	0.587
comGC	Lactococcus lactis subsp. cremoris KW2	58.416	97.115	0.567
comYC	Streptococcus suis isolate S10	61.364	84.615	0.519
comGC	Staphylococcus aureus MW2	50	75	0.375
comGC	Staphylococcus aureus N315	50	75	0.375