Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | AAA996_RS09790 | Genome accession | NZ_AP028606 |
| Coordinates | 1897375..1897701 (-) | Length | 108 a.a. |
| NCBI ID | WP_000738626.1 | Uniprot ID | Q8DN88 |
| Organism | Streptococcus pneumoniae strain Sep1 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1892375..1902701
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AAA996_RS09745 (TKY121773_18960) | rnpA | 1892392..1892763 (-) | 372 | WP_000739246.1 | ribonuclease P protein component | - |
| AAA996_RS09750 | - | 1892780..1892911 (-) | 132 | WP_000768904.1 | hypothetical protein | - |
| AAA996_RS09755 (TKY121773_18970) | - | 1892912..1894102 (-) | 1191 | WP_000167766.1 | acetate kinase | - |
| AAA996_RS09760 (TKY121773_18980) | comYH | 1894153..1895106 (-) | 954 | WP_000345101.1 | class I SAM-dependent methyltransferase | Machinery gene |
| AAA996_RS09765 | - | 1895167..1895761 (-) | 595 | Protein_1898 | methyltransferase domain-containing protein | - |
| AAA996_RS09770 (TKY121773_19010) | comGG/cglG | 1895898..1896311 (-) | 414 | WP_000265624.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| AAA996_RS09775 (TKY121773_19020) | comGF/cglF | 1896289..1896750 (-) | 462 | WP_000250542.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| AAA996_RS09780 (TKY121773_19030) | comGE/cglE | 1896713..1897015 (-) | 303 | WP_000413382.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| AAA996_RS09785 (TKY121773_19040) | comGD/cglD | 1896978..1897382 (-) | 405 | WP_000588013.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| AAA996_RS09790 (TKY121773_19050) | comGC/cglC | 1897375..1897701 (-) | 327 | WP_000738626.1 | comG operon protein ComGC | Machinery gene |
| AAA996_RS09795 (TKY121773_19060) | comGB/cglB | 1897703..1898719 (-) | 1017 | WP_078375398.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| AAA996_RS09800 (TKY121773_19070) | comGA/cglA/cilD | 1898667..1899608 (-) | 942 | WP_000249567.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| AAA996_RS09805 (TKY121773_19080) | - | 1899684..1900049 (-) | 366 | WP_000286415.1 | DUF1033 family protein | - |
| AAA996_RS09810 (TKY121773_19090) | - | 1900200..1901258 (-) | 1059 | WP_000649473.1 | zinc-dependent alcohol dehydrogenase family protein | - |
| AAA996_RS09815 (TKY121773_19100) | nagA | 1901421..1902572 (-) | 1152 | WP_001134457.1 | N-acetylglucosamine-6-phosphate deacetylase | - |
Sequence
Protein
Download Length: 108 a.a. Molecular weight: 12200.38 Da Isoelectric Point: 10.1877
>NTDB_id=106234 AAA996_RS09790 WP_000738626.1 1897375..1897701(-) (comGC/cglC) [Streptococcus pneumoniae strain Sep1]
MKKMMTFLKKAKVKAFTLVEMLVVLLIISVLFLLFVPNLTKQKEAVNDKGKAAVVKVVESQAELYSLEKNEDASLRKLQA
DGRITEEQAKAYKEYHDKNGGANRKVND
MKKMMTFLKKAKVKAFTLVEMLVVLLIISVLFLLFVPNLTKQKEAVNDKGKAAVVKVVESQAELYSLEKNEDASLRKLQA
DGRITEEQAKAYKEYHDKNGGANRKVND
Nucleotide
Download Length: 327 bp
>NTDB_id=106234 AAA996_RS09790 WP_000738626.1 1897375..1897701(-) (comGC/cglC) [Streptococcus pneumoniae strain Sep1]
ATGAAAAAAATGATGACATTCTTGAAAAAAGCTAAGGTTAAAGCTTTTACATTGGTGGAAATGTTGGTGGTCTTGCTGAT
TATCAGCGTGCTTTTCTTGCTCTTTGTACCTAATCTGACCAAGCAAAAAGAAGCAGTCAATGACAAAGGAAAAGCAGCTG
TTGTTAAGGTGGTGGAAAGCCAGGCAGAACTTTATAGCTTAGAAAAGAATGAAGATGCTAGCCTAAGAAAGTTACAAGCA
GATGGACGCATCACGGAAGAACAGGCTAAAGCTTATAAAGAATACCATGATAAAAATGGAGGAGCAAATCGTAAAGTCAA
TGATTAA
ATGAAAAAAATGATGACATTCTTGAAAAAAGCTAAGGTTAAAGCTTTTACATTGGTGGAAATGTTGGTGGTCTTGCTGAT
TATCAGCGTGCTTTTCTTGCTCTTTGTACCTAATCTGACCAAGCAAAAAGAAGCAGTCAATGACAAAGGAAAAGCAGCTG
TTGTTAAGGTGGTGGAAAGCCAGGCAGAACTTTATAGCTTAGAAAAGAATGAAGATGCTAGCCTAAGAAAGTTACAAGCA
GATGGACGCATCACGGAAGAACAGGCTAAAGCTTATAAAGAATACCATGATAAAAATGGAGGAGCAAATCGTAAAGTCAA
TGATTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae D39 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae R6 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
99.074 |
100 |
0.991 |
| comGC/cglC | Streptococcus mitis SK321 |
94.444 |
100 |
0.944 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
92.157 |
94.444 |
0.87 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
67.961 |
95.37 |
0.648 |
| comYC | Streptococcus mutans UA140 |
62.745 |
94.444 |
0.593 |
| comYC | Streptococcus mutans UA159 |
62.745 |
94.444 |
0.593 |
| comYC | Streptococcus suis isolate S10 |
70.37 |
75 |
0.528 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
53.922 |
94.444 |
0.509 |
| comGC | Staphylococcus aureus MW2 |
50 |
79.63 |
0.398 |
| comGC | Staphylococcus aureus N315 |
50 |
79.63 |
0.398 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
45.349 |
79.63 |
0.361 |