Detailed information NTG1036453

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: ACA346_RS09820
• Genome accession: NZ_CP166970
• Coordinates: 1930034..1930312 (-)
• Length: 92 a.a.
• NCBI ID: WP_217374331.1
• Uniprot ID: -
• Organism: Streptococcus parasuis strain NX1
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1925034..1935312

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACA346_RS09785 (ACA346_09785)	-	1925460..1926011 (-)	552	WP_277845146.1	folate family ECF transporter S component	-
ACA346_RS09790 (ACA346_09790)	-	1926266..1927453 (-)	1188	WP_277837563.1	acetate kinase	-
ACA346_RS09795 (ACA346_09795)	comYH	1927503..1928456 (-)	954	WP_418126813.1	class I SAM-dependent methyltransferase	Machinery gene
ACA346_RS09800 (ACA346_09800)	comGG	1928476..1928976 (-)	501	WP_418127599.1	competence type IV pilus minor pilin ComGG	-
ACA346_RS09805 (ACA346_09805)	comYF	1928954..1929412 (-)	459	WP_418126814.1	competence type IV pilus minor pilin ComGF	Machinery gene
ACA346_RS09810 (ACA346_09810)	comGE	1929375..1929668 (-)	294	WP_105126461.1	competence type IV pilus minor pilin ComGE	-
ACA346_RS09815 (ACA346_09815)	comGD	1929640..1930044 (-)	405	WP_418126815.1	competence type IV pilus minor pilin ComGD	-
ACA346_RS09820 (ACA346_09820)	comYC	1930034..1930312 (-)	279	WP_217374331.1	competence type IV pilus major pilin ComGC	Machinery gene
ACA346_RS09825 (ACA346_09825)	comYB	1930314..1931351 (-)	1038	WP_318151035.1	competence type IV pilus assembly protein ComGB	Machinery gene
ACA346_RS09830 (ACA346_09830)	comYA	1931263..1932213 (-)	951	WP_318150623.1	competence type IV pilus ATPase ComGA	Machinery gene
ACA346_RS09835 (ACA346_09835)	-	1932301..1933251 (+)	951	WP_418127600.1	S66 family peptidase	-
ACA346_RS09840 (ACA346_09840)	-	1933312..1933653 (-)	342	WP_217374334.1	DUF1033 family protein	-

Sequence

Protein

• Length: 92 a.a.
• Molecular weight: 10588.57 Da
• Isoelectric Point: 7.0112

>NTDB_id=1036453 ACA346_RS09820 WP_217374331.1 1930034..1930312(-) (comYC) [Streptococcus parasuis strain NX1]
MKKMLKKKVKGFTLVEMLVVLGIISILLLLFVPNLSKQKQKIQEDGNAVVVKVVESQMDIYELEHGVRPTAEELYNQQMI
TEDQLEKYNNVP

Nucleotide

• Length: 279 bp

>NTDB_id=1036453 ACA346_RS09820 WP_217374331.1 1930034..1930312(-) (comYC) [Streptococcus parasuis strain NX1]
ATGAAAAAAATGTTGAAAAAGAAAGTCAAAGGATTCACTTTGGTCGAAATGTTAGTGGTGCTTGGAATTATTAGTATTCT
CTTACTATTATTTGTGCCAAATCTCAGTAAGCAAAAGCAAAAAATACAAGAAGACGGCAATGCGGTGGTTGTAAAAGTTG
TTGAAAGTCAAATGGACATTTACGAATTGGAGCATGGTGTTCGTCCAACAGCGGAAGAATTATATAATCAGCAGATGATA
ACTGAAGATCAACTAGAAAAATATAATAATGTACCTTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus suis isolate S10	63.736	98.913	0.63
comGC/cglC	Streptococcus mitis SK321	55.914	100	0.565
comGC/cglC	Streptococcus pneumoniae TIGR4	55.435	100	0.554
comGC/cglC	Streptococcus pneumoniae Rx1	55.435	100	0.554
comGC/cglC	Streptococcus pneumoniae D39	55.435	100	0.554
comGC/cglC	Streptococcus pneumoniae R6	55.435	100	0.554
comGC/cglC	Streptococcus mitis NCTC 12261	55.435	100	0.554
comYC	Streptococcus gordonii str. Challis substr. CH1	55.056	96.739	0.533
comGC	Lactococcus lactis subsp. cremoris KW2	54.444	97.826	0.533
comYC	Streptococcus mutans UA159	53.333	97.826	0.522
comYC	Streptococcus mutans UA140	53.333	97.826	0.522
comGC	Staphylococcus aureus MW2	46.835	85.87	0.402
comGC	Staphylococcus aureus N315	46.835	85.87	0.402
comGC	Bacillus subtilis subsp. subtilis str. 168	46.667	81.522	0.38