Detailed information NTG1025506

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: AB3443_RS02630
• Genome accession: NZ_CP162437
• Coordinates: 505580..505891 (+)
• Length: 103 a.a.
• NCBI ID: WP_000472256.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain TUM22698
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 500580..510891

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
AB3443_RS02600 (AB3443_02600)	-	501363..501566 (+)	204	WP_000087561.1	YqgQ family protein	-
AB3443_RS02605 (AB3443_02605)	-	501563..502549 (+)	987	WP_000161314.1	ROK family glucokinase	-
AB3443_RS02610 (AB3443_02610)	-	502549..502878 (+)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
AB3443_RS02615 (AB3443_02615)	-	502875..503498 (+)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
AB3443_RS02620 (AB3443_02620)	comGA	503550..504524 (+)	975	WP_000697228.1	competence type IV pilus ATPase ComGA	Machinery gene
AB3443_RS02625 (AB3443_02625)	comGB	504496..505566 (+)	1071	WP_000775708.1	competence type IV pilus assembly protein ComGB	Machinery gene
AB3443_RS02630 (AB3443_02630)	comGC	505580..505891 (+)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
AB3443_RS02635 (AB3443_02635)	comGD	505869..506315 (+)	447	WP_001790850.1	competence type IV pilus minor pilin ComGD	Machinery gene
AB3443_RS02640 (AB3443_02640)	comGE	506302..506601 (+)	300	WP_000844413.1	hypothetical protein	Machinery gene
AB3443_RS02645 (AB3443_02645)	comGF	506519..506941 (+)	423	WP_258922346.1	competence type IV pilus minor pilin ComGF	Machinery gene
AB3443_RS02650 (AB3443_02650)	-	507019..508191 (+)	1173	WP_000195429.1	IS256-like element IS256 family transposase	-
AB3443_RS02655 (AB3443_02655)	-	508244..508348 (+)	105	Protein_487	type IV pilus minor pilin ComGF family protein	-
AB3443_RS02660 (AB3443_02660)	-	508445..508591 (+)	147	WP_001789879.1	hypothetical protein	-
AB3443_RS02665 (AB3443_02665)	-	508581..509105 (+)	525	WP_001015117.1	shikimate kinase	-
AB3443_RS02670 (AB3443_02670)	gcvT	509264..510355 (+)	1092	WP_000093349.1	glycine cleavage system aminomethyltransferase GcvT	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11315.36 Da
• Isoelectric Point: 8.5268

>NTDB_id=1025506 AB3443_RS02630 WP_000472256.1 505580..505891(+) (comGC) [Staphylococcus aureus strain TUM22698]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=1025506 AB3443_RS02630 WP_000472256.1 505580..505891(+) (comGC) [Staphylococcus aureus strain TUM22698]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369