Detailed information NTG1022569

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: AB1395_RS00755
• Genome accession: NZ_CP161815
• Coordinates: 137116..137409 (+)
• Length: 97 a.a.
• NCBI ID: WP_367783523.1
• Uniprot ID: -
• Organism: Streptococcus pluranimalium strain SS-15
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 132116..142409

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
AB1395_RS00740 (AB1395_00740)	-	134767..135147 (+)	381	WP_218653889.1	DUF1033 family protein	-
AB1395_RS00745 (AB1395_00745)	comYA	135210..136163 (+)	954	WP_367783521.1	competence type IV pilus ATPase ComGA	Machinery gene
AB1395_RS00750 (AB1395_00750)	comYB	136087..137115 (+)	1029	WP_367784195.1	competence type IV pilus assembly protein ComGB	Machinery gene
AB1395_RS00755 (AB1395_00755)	comYC	137116..137409 (+)	294	WP_367783523.1	competence type IV pilus major pilin ComGC	Machinery gene
AB1395_RS00760 (AB1395_00760)	comGD	137390..137806 (+)	417	WP_278024843.1	competence type IV pilus minor pilin ComGD	-
AB1395_RS00765 (AB1395_00765)	comGE	137778..138077 (+)	300	WP_367783525.1	competence type IV pilus minor pilin ComGE	-
AB1395_RS00770 (AB1395_00770)	comYF	138055..138492 (+)	438	WP_367783527.1	competence type IV pilus minor pilin ComGF	Machinery gene
AB1395_RS00775 (AB1395_00775)	comGG	138470..138871 (+)	402	WP_367783529.1	competence type IV pilus minor pilin ComGG	-
AB1395_RS00780 (AB1395_00780)	comYH	138914..139867 (+)	954	WP_218653896.1	class I SAM-dependent methyltransferase	Machinery gene
AB1395_RS00785 (AB1395_00785)	-	139928..141118 (+)	1191	WP_316605957.1	acetate kinase	-
AB1395_RS00790 (AB1395_00790)	-	141481..141678 (+)	198	WP_218653898.1	helix-turn-helix transcriptional regulator	-
AB1395_RS00795 (AB1395_00795)	-	141691..142143 (+)	453	WP_218653899.1	hypothetical protein	-

Sequence

Protein

• Length: 97 a.a.
• Molecular weight: 11120.22 Da
• Isoelectric Point: 9.8115

>NTDB_id=1022569 AB1395_RS00755 WP_367783523.1 137116..137409(+) (comYC) [Streptococcus pluranimalium strain SS-15]
MTYYWKQIKRKSVKAFTLLEMLFVLLIISVLMLLFVPNLSKQKAAVDEKGKAAVVKVVESQMELYEMKEDTKPSIQQLVD
GGYITQKQADTYAEAKK

Nucleotide

• Length: 294 bp

>NTDB_id=1022569 AB1395_RS00755 WP_367783523.1 137116..137409(+) (comYC) [Streptococcus pluranimalium strain SS-15]
GTGACATATTATTGGAAACAAATTAAACGAAAAAGTGTAAAAGCTTTCACACTTTTGGAAATGCTCTTCGTGCTTCTTAT
CATCAGTGTGCTTATGCTTTTGTTTGTGCCTAATTTGAGCAAGCAAAAGGCGGCTGTTGATGAGAAAGGAAAGGCAGCAG
TAGTAAAGGTTGTCGAGAGTCAGATGGAGTTGTATGAAATGAAAGAAGATACCAAACCATCTATTCAACAATTAGTGGAT
GGTGGTTATATTACGCAAAAGCAAGCTGATACTTATGCAGAAGCTAAGAAGTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (10-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus gordonii str. Challis substr. CH1	64.773	90.722	0.588
comYC	Streptococcus suis isolate S10	65.882	87.629	0.577
comGC/cglC	Streptococcus pneumoniae Rx1	63.218	89.691	0.567
comGC/cglC	Streptococcus pneumoniae D39	63.218	89.691	0.567
comGC/cglC	Streptococcus pneumoniae R6	63.218	89.691	0.567
comGC/cglC	Streptococcus mitis NCTC 12261	63.218	89.691	0.567
comGC/cglC	Streptococcus mitis SK321	63.218	89.691	0.567
comGC/cglC	Streptococcus pneumoniae TIGR4	63.218	89.691	0.567
comYC	Streptococcus mutans UA140	60.674	91.753	0.557
comYC	Streptococcus mutans UA159	60.674	91.753	0.557
comGC	Lactococcus lactis subsp. cremoris KW2	55.435	94.845	0.526
comGC	Staphylococcus aureus MW2	48.101	81.443	0.392
comGC	Staphylococcus aureus N315	48.101	81.443	0.392