Detailed information NTG1009087

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: ABKA15_RS01280
• Genome accession: NZ_CP157941
• Coordinates: 246835..247152 (+)
• Length: 105 a.a.
• NCBI ID: WP_003028473.1
• Uniprot ID: A0A0P0N5S2
• Organism: Streptococcus sp. KHUD_010
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 241835..252152

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ABKA15_RS01250 (ABKA15_01245)	-	241915..242415 (+)	501	Protein_243	aromatic acid exporter family protein	-
ABKA15_RS01255 (ABKA15_01250)	-	242577..242957 (+)	381	WP_350015362.1	MerR family transcriptional regulator	-
ABKA15_RS01260 (ABKA15_01255)	glnA	242968..244310 (+)	1343	Protein_245	type I glutamate--ammonia ligase	-
ABKA15_RS01265 (ABKA15_01260)	-	244498..244863 (+)	366	WP_049507022.1	DUF1033 family protein	-
ABKA15_RS01270 (ABKA15_01265)	comYA	244933..245874 (+)	942	WP_049513218.1	competence type IV pilus ATPase ComGA	Machinery gene
ABKA15_RS01275 (ABKA15_01270)	comYB	245816..246838 (+)	1023	WP_185952230.1	competence type IV pilus assembly protein ComGB	Machinery gene
ABKA15_RS01280 (ABKA15_01275)	comYC	246835..247152 (+)	318	WP_003028473.1	competence type IV pilus major pilin ComGC	Machinery gene
ABKA15_RS01285 (ABKA15_01280)	comYD	247112..247540 (+)	429	WP_049507639.1	competence type IV pilus minor pilin ComGD	Machinery gene
ABKA15_RS01290 (ABKA15_01285)	comGE/cglE	247512..247805 (+)	294	WP_049513214.1	competence type IV pilus minor pilin ComGE	Machinery gene
ABKA15_RS01295 (ABKA15_01290)	comGF/cglF	247789..248226 (+)	438	WP_049513212.1	competence type IV pilus minor pilin ComGF	Machinery gene
ABKA15_RS01300 (ABKA15_01295)	comGG	248207..248533 (+)	327	WP_264340993.1	competence type IV pilus minor pilin ComGG	-
ABKA15_RS01305 (ABKA15_01300)	comYH	248605..249558 (+)	954	WP_049513210.1	class I SAM-dependent methyltransferase	Machinery gene
ABKA15_RS01310 (ABKA15_01305)	-	249605..250804 (+)	1200	WP_049513208.1	acetate kinase	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11622.72 Da
• Isoelectric Point: 10.1006

>NTDB_id=1009087 ABKA15_RS01280 WP_003028473.1 246835..247152(+) (comYC) [Streptococcus sp. KHUD_010]
MKKLKSLKVKGFTLVEMLVVLLIISVLMLLFVPNLTKQKEAVTEKGNAAVVKVVESQAELFEVNHTNEKATLSKLVNEGT
ITDKQAASYKAYYAKHTKEARSVAD

Nucleotide

• Length: 318 bp

>NTDB_id=1009087 ABKA15_RS01280 WP_003028473.1 246835..247152(+) (comYC) [Streptococcus sp. KHUD_010]
ATGAAAAAATTAAAAAGTTTGAAGGTTAAAGGTTTTACTTTAGTAGAAATGTTAGTCGTGCTTCTTATCATCAGTGTTTT
GATGCTCTTGTTCGTACCGAATTTGACCAAGCAAAAAGAAGCGGTGACGGAAAAAGGAAATGCAGCGGTGGTAAAAGTTG
TGGAAAGCCAAGCGGAGCTGTTTGAGGTCAATCACACCAATGAAAAAGCGACGCTCTCAAAATTAGTCAACGAAGGCACG
ATTACAGACAAGCAAGCGGCATCTTATAAGGCTTACTATGCGAAACATACAAAAGAAGCTCGTTCCGTTGCAGATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

3D structure

• AlphaFold DB: A0A0P0N5S2

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus gordonii str. Challis substr. CH1	73.333	100	0.733
comYC	Streptococcus mutans UA159	66.667	100	0.667
comYC	Streptococcus mutans UA140	66.667	100	0.667
comGC/cglC	Streptococcus mitis NCTC 12261	68.627	97.143	0.667
comGC/cglC	Streptococcus mitis SK321	68.627	97.143	0.667
comGC/cglC	Streptococcus pneumoniae R6	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae D39	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae Rx1	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae TIGR4	66.667	97.143	0.648
comYC	Streptococcus suis isolate S10	66.292	84.762	0.562
comGC	Lactococcus lactis subsp. cremoris KW2	54.808	99.048	0.543