Detailed information
Overview
| Name | pilA2 | Type | Machinery gene |
| Locus tag | ABFU71_RS16015 | Genome accession | NZ_CP156016 |
| Coordinates | 3651872..3652303 (-) | Length | 143 a.a. |
| NCBI ID | WP_043922199.1 | Uniprot ID | - |
| Organism | Xanthomonas campestris pv. raphani strain 756C | ||
| Function | assembly of type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 3642495..3700525 | 3651872..3652303 | within | 0 |
Gene organization within MGE regions
Location: 3642495..3700525
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABFU71_RS15975 (ABFU71_15940) | - | 3642495..3642905 (-) | 411 | WP_029628876.1 | CopG family ribbon-helix-helix protein | - |
| ABFU71_RS15980 (ABFU71_15945) | sucD | 3643009..3643884 (-) | 876 | WP_011038208.1 | succinate--CoA ligase subunit alpha | - |
| ABFU71_RS15985 (ABFU71_15950) | sucC | 3643909..3645078 (-) | 1170 | WP_014508701.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| ABFU71_RS15990 (ABFU71_15955) | - | 3645312..3646922 (+) | 1611 | WP_014508702.1 | PAS domain-containing sensor histidine kinase | - |
| ABFU71_RS15995 (ABFU71_15960) | pilR | 3647131..3648525 (+) | 1395 | WP_043921909.1 | sigma-54 dependent transcriptional regulator | Regulator |
| ABFU71_RS16000 (ABFU71_15965) | - | 3648723..3649079 (+) | 357 | WP_323475264.1 | hypothetical protein | - |
| ABFU71_RS16005 (ABFU71_15970) | - | 3649024..3649815 (+) | 792 | WP_202796265.1 | toxin | - |
| ABFU71_RS16010 (ABFU71_15975) | pilB | 3649998..3651734 (-) | 1737 | WP_043921911.1 | type IV-A pilus assembly ATPase PilB | Machinery gene |
| ABFU71_RS16015 (ABFU71_15980) | pilA2 | 3651872..3652303 (-) | 432 | WP_043922199.1 | pilin | Machinery gene |
| ABFU71_RS16020 (ABFU71_15985) | - | 3652652..3653909 (+) | 1258 | Protein_3097 | type II secretion system F family protein | - |
| ABFU71_RS16025 (ABFU71_15990) | - | 3653916..3654779 (+) | 864 | WP_011038216.1 | A24 family peptidase | - |
| ABFU71_RS16030 (ABFU71_15995) | coaE | 3654793..3655416 (+) | 624 | WP_014508710.1 | dephospho-CoA kinase | - |
| ABFU71_RS16035 (ABFU71_16000) | - | 3655948..3656349 (+) | 402 | WP_043921912.1 | SymE family type I addiction module toxin | - |
| ABFU71_RS16040 (ABFU71_16005) | - | 3656424..3656714 (+) | 291 | WP_014508712.1 | DUF1778 domain-containing protein | - |
| ABFU71_RS16045 (ABFU71_16010) | - | 3656711..3657202 (+) | 492 | WP_014508713.1 | GNAT family N-acetyltransferase | - |
| ABFU71_RS16050 (ABFU71_16015) | - | 3657345..3658679 (-) | 1335 | WP_012437598.1 | HAMP domain-containing sensor histidine kinase | - |
| ABFU71_RS16055 (ABFU71_16020) | - | 3658672..3659349 (-) | 678 | WP_003490678.1 | response regulator transcription factor | - |
| ABFU71_RS16060 (ABFU71_16025) | rimK | 3659999..3660874 (-) | 876 | WP_043921913.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
| ABFU71_RS16065 (ABFU71_16030) | glgX | 3661367..3663496 (+) | 2130 | WP_014508716.1 | glycogen debranching protein GlgX | - |
| ABFU71_RS16070 (ABFU71_16035) | - | 3664038..3664430 (-) | 393 | WP_011038224.1 | H-NS family nucleoid-associated regulatory protein | - |
| ABFU71_RS16075 (ABFU71_16040) | - | 3664521..3664916 (-) | 396 | WP_042594933.1 | hypothetical protein | - |
| ABFU71_RS16080 (ABFU71_16045) | - | 3665092..3665247 (-) | 156 | WP_042594934.1 | hypothetical protein | - |
| ABFU71_RS16085 (ABFU71_16050) | - | 3665365..3665706 (-) | 342 | WP_237704751.1 | hypothetical protein | - |
| ABFU71_RS16090 (ABFU71_16055) | - | 3665839..3666210 (-) | 372 | WP_014508721.1 | hypothetical protein | - |
| ABFU71_RS16095 (ABFU71_16060) | - | 3666893..3667234 (+) | 342 | WP_080565911.1 | hypothetical protein | - |
| ABFU71_RS16100 (ABFU71_16065) | - | 3667287..3668897 (-) | 1611 | WP_014508722.1 | MobA/MobL family protein | - |
| ABFU71_RS16105 (ABFU71_16070) | - | 3669165..3669491 (+) | 327 | WP_043921914.1 | conjugal transfer protein TraD | - |
| ABFU71_RS16110 (ABFU71_16075) | - | 3669754..3670023 (+) | 270 | WP_237704833.1 | HNH endonuclease | - |
| ABFU71_RS16115 (ABFU71_16080) | - | 3669981..3670574 (+) | 594 | WP_407465385.1 | hypothetical protein | - |
| ABFU71_RS16120 (ABFU71_16085) | - | 3670622..3671857 (+) | 1236 | WP_237704752.1 | HNH endonuclease | - |
| ABFU71_RS16125 (ABFU71_16090) | - | 3671869..3672495 (-) | 627 | WP_162470855.1 | hypothetical protein | - |
| ABFU71_RS16130 (ABFU71_16095) | - | 3672560..3676525 (-) | 3966 | WP_014508726.1 | hypothetical protein | - |
| ABFU71_RS16135 (ABFU71_16100) | - | 3676563..3677201 (-) | 639 | WP_043921915.1 | DUF1629 domain-containing protein | - |
| ABFU71_RS16140 (ABFU71_16105) | - | 3677334..3678698 (-) | 1365 | WP_014508728.1 | DNA double-strand break repair nuclease NurA | - |
| ABFU71_RS16145 (ABFU71_16110) | - | 3678701..3680791 (-) | 2091 | WP_014508729.1 | ATP-binding protein | - |
| ABFU71_RS16150 (ABFU71_16115) | - | 3680805..3681695 (-) | 891 | WP_033836759.1 | DNA adenine methylase | - |
| ABFU71_RS16155 (ABFU71_16120) | - | 3681913..3682104 (-) | 192 | WP_080565913.1 | hypothetical protein | - |
| ABFU71_RS16160 (ABFU71_16125) | - | 3682174..3682653 (-) | 480 | WP_014508730.1 | RadC family protein | - |
| ABFU71_RS16165 (ABFU71_16130) | - | 3683056..3683280 (-) | 225 | WP_039405436.1 | hypothetical protein | - |
| ABFU71_RS16170 (ABFU71_16135) | - | 3683474..3683920 (+) | 447 | WP_014508731.1 | hypothetical protein | - |
| ABFU71_RS16175 (ABFU71_16140) | - | 3684496..3685896 (+) | 1401 | WP_014508732.1 | site-specific integrase | - |
| ABFU71_RS16180 (ABFU71_16145) | - | 3686248..3687663 (+) | 1416 | WP_014508733.1 | hypothetical protein | - |
| ABFU71_RS16185 (ABFU71_16150) | - | 3687664..3688899 (-) | 1236 | WP_202796266.1 | abortive infection family protein | - |
| ABFU71_RS16190 (ABFU71_16155) | - | 3688944..3690137 (-) | 1194 | WP_014508735.1 | GIY-YIG nuclease family protein | - |
| ABFU71_RS16195 (ABFU71_16160) | - | 3690130..3692235 (-) | 2106 | WP_043921917.1 | DEAD/DEAH box helicase | - |
| ABFU71_RS16200 (ABFU71_16165) | - | 3692232..3695018 (-) | 2787 | WP_043921918.1 | DNA methyltransferase | - |
| ABFU71_RS16205 (ABFU71_16170) | - | 3695356..3695679 (-) | 324 | WP_108723645.1 | helix-turn-helix domain-containing protein | - |
| ABFU71_RS16210 (ABFU71_16175) | - | 3695784..3696536 (+) | 753 | WP_014508739.1 | hypothetical protein | - |
| ABFU71_RS16215 (ABFU71_16180) | - | 3696579..3696893 (+) | 315 | WP_014508740.1 | hypothetical protein | - |
| ABFU71_RS16220 (ABFU71_16185) | - | 3696890..3697270 (+) | 381 | WP_193387299.1 | hypothetical protein | - |
| ABFU71_RS16225 (ABFU71_16190) | - | 3697529..3698527 (-) | 999 | WP_148263074.1 | hypothetical protein | - |
| ABFU71_RS16230 (ABFU71_16195) | - | 3698564..3698746 (-) | 183 | WP_141762696.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 143 a.a. Molecular weight: 14758.07 Da Isoelectric Point: 9.0331
>NTDB_id=1001248 ABFU71_RS16015 WP_043922199.1 3651872..3652303(-) (pilA2) [Xanthomonas campestris pv. raphani strain 756C]
MKKQQGFTLIELMIVIAIIAILAAIALPAYQDYTIRSKVSETMIAMSAAKLAVAETAQSQGILATAVTNNTAAGYSGQTT
DKVASVVIANGVVTGTSKNTGAKVEPILKLTPTQADKDSPITWACSYTAGEAKHVPASCRTAG
MKKQQGFTLIELMIVIAIIAILAAIALPAYQDYTIRSKVSETMIAMSAAKLAVAETAQSQGILATAVTNNTAAGYSGQTT
DKVASVVIANGVVTGTSKNTGAKVEPILKLTPTQADKDSPITWACSYTAGEAKHVPASCRTAG
Nucleotide
Download Length: 432 bp
>NTDB_id=1001248 ABFU71_RS16015 WP_043922199.1 3651872..3652303(-) (pilA2) [Xanthomonas campestris pv. raphani strain 756C]
ATGAAAAAGCAGCAAGGTTTTACTCTTATTGAATTGATGATTGTTATTGCCATCATCGCGATCCTAGCCGCCATTGCTCT
TCCGGCATATCAGGATTACACCATTCGAAGCAAAGTCAGCGAAACCATGATTGCTATGTCTGCAGCTAAGCTAGCGGTAG
CTGAGACTGCCCAGTCTCAAGGTATTCTGGCAACTGCCGTTACTAACAACACCGCCGCTGGATACTCCGGGCAAACTACC
GATAAGGTAGCGAGCGTGGTCATTGCCAATGGTGTGGTCACCGGTACTTCCAAGAACACTGGCGCAAAAGTTGAGCCGAT
CTTGAAGCTTACCCCCACGCAGGCTGATAAAGACTCGCCGATTACATGGGCTTGCAGCTACACCGCTGGTGAAGCTAAGC
ATGTCCCGGCAAGCTGCCGTACCGCTGGCTGA
ATGAAAAAGCAGCAAGGTTTTACTCTTATTGAATTGATGATTGTTATTGCCATCATCGCGATCCTAGCCGCCATTGCTCT
TCCGGCATATCAGGATTACACCATTCGAAGCAAAGTCAGCGAAACCATGATTGCTATGTCTGCAGCTAAGCTAGCGGTAG
CTGAGACTGCCCAGTCTCAAGGTATTCTGGCAACTGCCGTTACTAACAACACCGCCGCTGGATACTCCGGGCAAACTACC
GATAAGGTAGCGAGCGTGGTCATTGCCAATGGTGTGGTCACCGGTACTTCCAAGAACACTGGCGCAAAAGTTGAGCCGAT
CTTGAAGCTTACCCCCACGCAGGCTGATAAAGACTCGCCGATTACATGGGCTTGCAGCTACACCGCTGGTGAAGCTAAGC
ATGTCCCGGCAAGCTGCCGTACCGCTGGCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilA2 | Legionella pneumophila str. Paris |
51.02 |
100 |
0.524 |
| pilA2 | Legionella pneumophila strain ERS1305867 |
50.34 |
100 |
0.517 |
| pilE | Neisseria elongata subsp. glycolytica ATCC 29315 |
38.378 |
100 |
0.496 |
| comP | Acinetobacter baylyi ADP1 |
42.767 |
100 |
0.476 |
| pilE | Neisseria gonorrhoeae strain FA1090 |
40.764 |
100 |
0.448 |
| pilA | Ralstonia pseudosolanacearum GMI1000 |
37.952 |
100 |
0.441 |
| pilE | Neisseria gonorrhoeae MS11 |
39.873 |
100 |
0.441 |
| pilA/pilAI | Pseudomonas stutzeri DSM 10701 |
40.559 |
100 |
0.406 |
| pilA | Haemophilus influenzae 86-028NP |
39.716 |
98.601 |
0.392 |
| pilA | Haemophilus influenzae Rd KW20 |
38.462 |
100 |
0.385 |
| pilA/pilA1 | Eikenella corrodens VA1 |
36 |
100 |
0.378 |
| pilA | Vibrio cholerae C6706 |
35.811 |
100 |
0.371 |
| pilA | Vibrio cholerae strain A1552 |
35.811 |
100 |
0.371 |
| pilA | Vibrio cholerae O1 biovar El Tor strain E7946 |
35.811 |
100 |
0.371 |