Detailed information NTG1001123

Bioinformatically predicted

Overview

• Name: pilA
• Type: Machinery gene
• Locus tag: ABFU49_RS16565
• Genome accession: NZ_CP156008
• Coordinates: 3800551..3800979 (-)
• Length: 142 a.a.
• NCBI ID: WP_057671660.1
• Uniprot ID: -
• Organism: Xanthomonas campestris pv. campestris strain NBC831
• Function: type IV pilus biogenesis and function (predicted from homology) DNA binding and uptake

Genomic Context

Location: 3795551..3805979

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ABFU49_RS16540 (ABFU49_16505)	pilR	3795817..3797211 (+)	1395	WP_043921909.1	sigma-54 dependent transcriptional regulator	Regulator
ABFU49_RS16545 (ABFU49_16510)	-	3797403..3797765 (+)	363	WP_217694196.1	hypothetical protein	-
ABFU49_RS16550 (ABFU49_16515)	-	3797765..3798205 (+)	441	WP_274375534.1	hypothetical protein	-
ABFU49_RS16555 (ABFU49_16520)	-	3798287..3798502 (+)	216	WP_274375533.1	hypothetical protein	-
ABFU49_RS16560 (ABFU49_16525)	pilB	3798685..3800415 (-)	1731	WP_274375747.1	type IV-A pilus assembly ATPase PilB	Machinery gene
ABFU49_RS16565 (ABFU49_16530)	pilA	3800551..3800979 (-)	429	WP_057671660.1	pilin	Machinery gene
ABFU49_RS16570 (ABFU49_16535)	pilC	3801321..3802583 (+)	1263	WP_057671824.1	type II secretion system F family protein	Machinery gene
ABFU49_RS16575 (ABFU49_16540)	-	3802590..3803453 (+)	864	WP_057671659.1	A24 family peptidase	-
ABFU49_RS16580 (ABFU49_16545)	coaE	3803467..3804090 (+)	624	WP_040940796.1	dephospho-CoA kinase	-
ABFU49_RS16585 (ABFU49_16550)	-	3804622..3805023 (+)	402	WP_012437599.1	SymE family type I addiction module toxin	-
ABFU49_RS16590 (ABFU49_16555)	-	3805098..3805388 (+)	291	WP_011038219.1	DUF1778 domain-containing protein	-
ABFU49_RS16595 (ABFU49_16560)	-	3805385..3805876 (+)	492	WP_011038220.1	GNAT family N-acetyltransferase	-

Sequence

Protein

• Length: 142 a.a.
• Molecular weight: 14272.35 Da
• Isoelectric Point: 9.1206

>NTDB_id=1001123 ABFU49_RS16565 WP_057671660.1 3800551..3800979(-) (pilA) [Xanthomonas campestris pv. campestris strain NBC831]
MKKQQGFTLIELMIVVAIIAILAAIALPAYQDYTVRGRVSEAMVAASAAKTVVAENAANGSALDSGWTAPTATNNVASVA
VATATGNITVTTTAKAGGGTIIFAPSANGAALASGTVPTDRISWDCKGGTLAAKYRPAECRT

Nucleotide

• Length: 429 bp

>NTDB_id=1001123 ABFU49_RS16565 WP_057671660.1 3800551..3800979(-) (pilA) [Xanthomonas campestris pv. campestris strain NBC831]
ATGAAAAAGCAACAAGGCTTTACCCTGATCGAACTGATGATCGTTGTCGCGATCATCGCAATCCTTGCCGCCATCGCGCT
GCCGGCTTATCAGGACTACACCGTTCGCGGTCGTGTCTCTGAAGCAATGGTTGCTGCCTCTGCTGCCAAGACGGTTGTGG
CCGAGAATGCTGCGAACGGCTCCGCCCTAGACAGTGGTTGGACCGCTCCTACGGCAACTAACAATGTCGCCAGCGTCGCT
GTTGCTACCGCTACGGGCAATATCACTGTTACTACCACTGCCAAGGCCGGTGGCGGCACGATAATCTTTGCTCCCTCGGC
TAACGGTGCTGCACTGGCTTCCGGTACTGTTCCAACCGATCGTATTTCTTGGGATTGCAAGGGCGGCACCTTGGCTGCCA
AGTACCGTCCAGCTGAATGCCGCACCTAA

Domains

Predicted by InterProScan.

• Pilin (bacterial filament) (Pilin) (35-141)

• Prokaryotic N-terminal methylation motif (N_methyl) (1-27)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA	Ralstonia pseudosolanacearum GMI1000	52.201	100	0.585
pilA2	Legionella pneumophila str. Paris	54.795	100	0.563
pilA2	Legionella pneumophila strain ERS1305867	54.795	100	0.563
comP	Acinetobacter baylyi ADP1	47.771	100	0.528
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	39.247	100	0.514
pilA/pilA1	Eikenella corrodens VA1	40	100	0.437
pilA/pilAI	Pseudomonas stutzeri DSM 10701	40.541	100	0.423
pilA/pilAII	Pseudomonas stutzeri DSM 10701	40.136	100	0.415
pilA	Acinetobacter baumannii strain A118	40.426	99.296	0.401
pilA	Vibrio cholerae C6706	33.766	100	0.366
pilA	Vibrio cholerae strain A1552	33.766	100	0.366
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	33.766	100	0.366