Detailed information
Overview
| Name | comP | Type | Machinery gene |
| Locus tag | ABFT89_RS16965 | Genome accession | NZ_CP155977 |
| Coordinates | 3839197..3839628 (-) | Length | 143 a.a. |
| NCBI ID | WP_024939397.1 | Uniprot ID | - |
| Organism | Xanthomonas campestris pv. campestris strain bglFP 6746 | ||
| Function | assembly of type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 3829103..3882194 | 3839197..3839628 | within | 0 |
Gene organization within MGE regions
Location: 3829103..3882194
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABFT89_RS16915 (ABFT89_16910) | - | 3829103..3829405 (-) | 303 | WP_011038207.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| ABFT89_RS16920 (ABFT89_16915) | - | 3829409..3829819 (-) | 411 | WP_029217117.1 | CopG family ribbon-helix-helix protein | - |
| ABFT89_RS16925 (ABFT89_16920) | sucD | 3829923..3830798 (-) | 876 | WP_011038208.1 | succinate--CoA ligase subunit alpha | - |
| ABFT89_RS16930 (ABFT89_16925) | sucC | 3830823..3831992 (-) | 1170 | WP_012437609.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| ABFT89_RS16935 (ABFT89_16930) | - | 3832226..3833836 (+) | 1611 | WP_407472602.1 | sensor histidine kinase | - |
| ABFT89_RS16940 (ABFT89_16935) | pilR | 3834045..3835439 (+) | 1395 | WP_043921909.1 | sigma-54 dependent transcriptional regulator | Regulator |
| ABFT89_RS16945 (ABFT89_16940) | - | 3835730..3835993 (+) | 264 | WP_407366831.1 | hypothetical protein | - |
| ABFT89_RS16950 (ABFT89_16945) | - | 3835993..3836730 (+) | 738 | WP_283269169.1 | zeta toxin family protein | - |
| ABFT89_RS16955 (ABFT89_16950) | pilB | 3836913..3838645 (-) | 1733 | Protein_3271 | type IV-A pilus assembly ATPase PilB | - |
| ABFT89_RS16960 (ABFT89_16955) | - | 3838687..3839100 (-) | 414 | WP_283269165.1 | pilin | - |
| ABFT89_RS16965 (ABFT89_16960) | comP | 3839197..3839628 (-) | 432 | WP_024939397.1 | pilin | Machinery gene |
| ABFT89_RS16970 (ABFT89_16965) | - | 3839976..3841234 (+) | 1259 | Protein_3274 | type II secretion system F family protein | - |
| ABFT89_RS16975 (ABFT89_16970) | - | 3841241..3842104 (+) | 864 | WP_040940797.1 | A24 family peptidase | - |
| ABFT89_RS16980 (ABFT89_16975) | coaE | 3842118..3842741 (+) | 624 | WP_228424129.1 | dephospho-CoA kinase | - |
| ABFT89_RS16985 (ABFT89_16980) | - | 3843270..3843671 (+) | 402 | WP_283269159.1 | SymE family type I addiction module toxin | - |
| ABFT89_RS16990 (ABFT89_16985) | - | 3843746..3844036 (+) | 291 | WP_011038219.1 | DUF1778 domain-containing protein | - |
| ABFT89_RS16995 (ABFT89_16990) | - | 3844033..3844524 (+) | 492 | WP_223646366.1 | GNAT family N-acetyltransferase | - |
| ABFT89_RS17000 (ABFT89_16995) | - | 3844667..3846001 (-) | 1335 | WP_012437598.1 | HAMP domain-containing sensor histidine kinase | - |
| ABFT89_RS17005 (ABFT89_17000) | - | 3845994..3846671 (-) | 678 | WP_003490678.1 | response regulator transcription factor | - |
| ABFT89_RS17010 (ABFT89_17005) | rimK | 3847321..3848196 (-) | 876 | WP_011038222.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
| ABFT89_RS17015 (ABFT89_17010) | glgX | 3848689..3850818 (+) | 2130 | WP_283269153.1 | glycogen debranching protein GlgX | - |
| ABFT89_RS17020 (ABFT89_17015) | - | 3851357..3851749 (-) | 393 | WP_011038224.1 | H-NS family nucleoid-associated regulatory protein | - |
| ABFT89_RS17025 (ABFT89_17020) | - | 3851840..3852235 (-) | 396 | WP_011038225.1 | hypothetical protein | - |
| ABFT89_RS17030 (ABFT89_17025) | - | 3852420..3852566 (-) | 147 | WP_116889157.1 | hypothetical protein | - |
| ABFT89_RS17035 (ABFT89_17030) | - | 3852630..3852860 (+) | 231 | WP_283269150.1 | hypothetical protein | - |
| ABFT89_RS17040 (ABFT89_17035) | - | 3853150..3853521 (-) | 372 | WP_407472603.1 | hypothetical protein | - |
| ABFT89_RS17045 (ABFT89_17040) | - | 3854216..3854557 (+) | 342 | WP_283269146.1 | hypothetical protein | - |
| ABFT89_RS17050 (ABFT89_17045) | - | 3854610..3856205 (-) | 1596 | WP_407472715.1 | MobA/MobL family protein | - |
| ABFT89_RS17060 (ABFT89_17055) | - | 3857603..3858829 (-) | 1227 | WP_167766504.1 | hypothetical protein | - |
| ABFT89_RS17065 (ABFT89_17060) | - | 3858883..3860835 (-) | 1953 | WP_283269142.1 | hypothetical protein | - |
| ABFT89_RS17070 (ABFT89_17065) | - | 3861184..3861834 (-) | 651 | WP_167766506.1 | hypothetical protein | - |
| ABFT89_RS17075 (ABFT89_17070) | - | 3861874..3865897 (-) | 4024 | Protein_3295 | hypothetical protein | - |
| ABFT89_RS17080 (ABFT89_17075) | - | 3865931..3866527 (-) | 597 | WP_345782097.1 | DUF1629 domain-containing protein | - |
| ABFT89_RS17085 (ABFT89_17080) | - | 3866666..3867146 (-) | 481 | Protein_3297 | RadC family protein | - |
| ABFT89_RS17090 (ABFT89_17085) | - | 3867554..3867769 (-) | 216 | WP_167766510.1 | hypothetical protein | - |
| ABFT89_RS17095 (ABFT89_17090) | - | 3868315..3868473 (+) | 159 | Protein_3299 | integrase | - |
| ABFT89_RS17100 (ABFT89_17095) | - | 3868507..3869609 (-) | 1103 | Protein_3300 | IS3-like element IS1404 family transposase | - |
| ABFT89_RS17105 (ABFT89_17100) | - | 3869675..3870922 (+) | 1248 | Protein_3301 | site-specific integrase | - |
| ABFT89_RS17110 (ABFT89_17105) | - | 3871105..3871440 (-) | 336 | WP_167766512.1 | hypothetical protein | - |
| ABFT89_RS17115 (ABFT89_17110) | - | 3871467..3872996 (-) | 1530 | WP_209271699.1 | ATP-binding protein | - |
| ABFT89_RS17120 (ABFT89_17115) | dndD | 3873029..3875077 (-) | 2049 | WP_407472604.1 | DNA sulfur modification protein DndD | - |
| ABFT89_RS17125 (ABFT89_17125) | dndC | 3875303..3876433 (-) | 1131 | WP_167766515.1 | DNA phosphorothioation system sulfurtransferase DndC | - |
| ABFT89_RS17130 (ABFT89_17130) | - | 3876604..3876885 (-) | 282 | WP_407366844.1 | helix-turn-helix domain-containing protein | - |
| ABFT89_RS17135 (ABFT89_17135) | - | 3877047..3877808 (+) | 762 | WP_283269134.1 | hypothetical protein | - |
| ABFT89_RS17140 (ABFT89_17140) | - | 3877851..3878165 (+) | 315 | WP_283269132.1 | hypothetical protein | - |
| ABFT89_RS17145 (ABFT89_17145) | - | 3878183..3878542 (+) | 360 | WP_167766613.1 | hypothetical protein | - |
| ABFT89_RS17150 (ABFT89_17150) | - | 3879013..3879876 (+) | 864 | WP_167766519.1 | hypothetical protein | - |
| ABFT89_RS17155 (ABFT89_17155) | - | 3879892..3880638 (+) | 747 | WP_167766520.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 143 a.a. Molecular weight: 14594.80 Da Isoelectric Point: 8.4781
>NTDB_id=1000609 ABFT89_RS16965 WP_024939397.1 3839197..3839628(-) (comP) [Xanthomonas campestris pv. campestris strain bglFP 6746]
MKKQQGFTLIELMIVVAIIAILAAIALPAYQDYTIRSRVSELAVMASSFKTTVAENIANNGGALPADACVGVGATAATTN
MASIACTPASGNIVVTGDATKTKGTILTYAPTIPAAGNSAVGTTWTCTGSGSQTKYYPAECRR
MKKQQGFTLIELMIVVAIIAILAAIALPAYQDYTIRSRVSELAVMASSFKTTVAENIANNGGALPADACVGVGATAATTN
MASIACTPASGNIVVTGDATKTKGTILTYAPTIPAAGNSAVGTTWTCTGSGSQTKYYPAECRR
Nucleotide
Download Length: 432 bp
>NTDB_id=1000609 ABFT89_RS16965 WP_024939397.1 3839197..3839628(-) (comP) [Xanthomonas campestris pv. campestris strain bglFP 6746]
ATGAAGAAGCAACAAGGCTTTACCCTGATCGAACTGATGATCGTTGTTGCGATCATCGCCATCCTAGCCGCCATCGCGCT
TCCGGCGTATCAGGACTACACCATTCGCTCGCGCGTCTCGGAACTGGCTGTGATGGCTAGCTCCTTCAAGACCACCGTCG
CAGAAAATATAGCTAACAACGGCGGCGCTTTGCCGGCTGATGCTTGCGTGGGTGTTGGTGCTACGGCTGCGACTACCAAC
ATGGCGTCCATCGCCTGTACTCCCGCTTCTGGCAATATCGTTGTTACCGGTGATGCAACCAAAACTAAGGGTACGATTTT
GACCTACGCGCCCACCATTCCTGCGGCGGGCAACTCTGCGGTTGGTACGACCTGGACGTGCACGGGTAGCGGTAGCCAGA
CAAAGTACTATCCGGCTGAGTGCCGCCGCTAA
ATGAAGAAGCAACAAGGCTTTACCCTGATCGAACTGATGATCGTTGTTGCGATCATCGCCATCCTAGCCGCCATCGCGCT
TCCGGCGTATCAGGACTACACCATTCGCTCGCGCGTCTCGGAACTGGCTGTGATGGCTAGCTCCTTCAAGACCACCGTCG
CAGAAAATATAGCTAACAACGGCGGCGCTTTGCCGGCTGATGCTTGCGTGGGTGTTGGTGCTACGGCTGCGACTACCAAC
ATGGCGTCCATCGCCTGTACTCCCGCTTCTGGCAATATCGTTGTTACCGGTGATGCAACCAAAACTAAGGGTACGATTTT
GACCTACGCGCCCACCATTCCTGCGGCGGGCAACTCTGCGGTTGGTACGACCTGGACGTGCACGGGTAGCGGTAGCCAGA
CAAAGTACTATCCGGCTGAGTGCCGCCGCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comP | Acinetobacter baylyi ADP1 |
53.595 |
100 |
0.573 |
| pilA2 | Legionella pneumophila str. Paris |
55.634 |
99.301 |
0.552 |
| pilA2 | Legionella pneumophila strain ERS1305867 |
54.93 |
99.301 |
0.545 |
| pilA | Ralstonia pseudosolanacearum GMI1000 |
40.244 |
100 |
0.462 |
| pilA | Vibrio campbellii strain DS40M4 |
41.611 |
100 |
0.434 |
| pilA | Pseudomonas aeruginosa PAK |
37.342 |
100 |
0.413 |
| pilA/pilA1 | Eikenella corrodens VA1 |
38.816 |
100 |
0.413 |
| pilA/pilAI | Pseudomonas stutzeri DSM 10701 |
40.278 |
100 |
0.406 |
| pilA | Haemophilus influenzae 86-028NP |
39.161 |
100 |
0.392 |
| pilA | Haemophilus influenzae Rd KW20 |
38.462 |
100 |
0.385 |
| pilA/pilAII | Pseudomonas stutzeri DSM 10701 |
37.241 |
100 |
0.378 |
| pilA | Glaesserella parasuis strain SC1401 |
37.063 |
100 |
0.371 |
| pilA | Vibrio parahaemolyticus RIMD 2210633 |
41.085 |
90.21 |
0.371 |