Detailed information
Overview
| Name | pilA/pilAI | Type | Machinery gene |
| Locus tag | ABFU77_RS05015 | Genome accession | NZ_CP155972 |
| Coordinates | 1213589..1213987 (+) | Length | 132 a.a. |
| NCBI ID | WP_104570927.1 | Uniprot ID | - |
| Organism | Xanthomonas campestris pv. raphani strain bglFP 6790 | ||
| Function | assembly of type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 1200573..1231827 | 1213589..1213987 | within | 0 |
Gene organization within MGE regions
Location: 1200573..1231827
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABFU77_RS04945 (ABFU77_04930) | - | 1200573..1200719 (+) | 147 | WP_116889157.1 | hypothetical protein | - |
| ABFU77_RS04950 (ABFU77_04935) | - | 1200904..1201299 (+) | 396 | WP_011038225.1 | hypothetical protein | - |
| ABFU77_RS04955 (ABFU77_04940) | - | 1201390..1201782 (+) | 393 | WP_323542775.1 | H-NS family nucleoid-associated regulatory protein | - |
| ABFU77_RS04960 (ABFU77_04945) | glgX | 1202311..1204440 (-) | 2130 | WP_228943906.1 | glycogen debranching protein GlgX | - |
| ABFU77_RS04965 (ABFU77_04950) | rimK | 1204934..1205809 (+) | 876 | WP_076054142.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
| ABFU77_RS04970 (ABFU77_04955) | - | 1206032..1206505 (+) | 474 | WP_012437597.1 | hypothetical protein | - |
| ABFU77_RS04975 (ABFU77_04960) | - | 1206536..1207213 (+) | 678 | WP_003490678.1 | response regulator transcription factor | - |
| ABFU77_RS04980 (ABFU77_04965) | - | 1207206..1208540 (+) | 1335 | WP_012437598.1 | HAMP domain-containing sensor histidine kinase | - |
| ABFU77_RS04985 (ABFU77_04970) | - | 1208683..1209174 (-) | 492 | WP_323534157.1 | GNAT family N-acetyltransferase | - |
| ABFU77_RS04990 (ABFU77_04975) | - | 1209171..1209461 (-) | 291 | WP_014508712.1 | DUF1778 domain-containing protein | - |
| ABFU77_RS04995 (ABFU77_04980) | - | 1209536..1209937 (-) | 402 | WP_181921862.1 | SymE family type I addiction module toxin | - |
| ABFU77_RS05000 (ABFU77_04985) | coaE | 1210469..1211092 (-) | 624 | WP_116901791.1 | dephospho-CoA kinase | - |
| ABFU77_RS05005 (ABFU77_04990) | - | 1211106..1211969 (-) | 864 | WP_011038216.1 | A24 family peptidase | - |
| ABFU77_RS05010 (ABFU77_04995) | pilC | 1211976..1213238 (-) | 1263 | WP_104570928.1 | type II secretion system F family protein | Machinery gene |
| ABFU77_RS05015 (ABFU77_05000) | pilA/pilAI | 1213589..1213987 (+) | 399 | WP_104570927.1 | pilin | Machinery gene |
| ABFU77_RS05020 (ABFU77_05005) | - | 1214088..1214510 (+) | 423 | WP_104570926.1 | pilin | - |
| ABFU77_RS05025 (ABFU77_05010) | - | 1214569..1216389 (+) | 1821 | WP_147308815.1 | hypothetical protein | - |
| ABFU77_RS05030 (ABFU77_05015) | - | 1216513..1217271 (+) | 759 | WP_323534158.1 | class I SAM-dependent methyltransferase | - |
| ABFU77_RS05035 (ABFU77_05020) | - | 1217768..1218454 (+) | 687 | WP_258872788.1 | glycosyltransferase family 9 protein | - |
| ABFU77_RS05040 (ABFU77_05025) | - | 1218457..1219299 (-) | 843 | WP_147308817.1 | glycosyltransferase | - |
| ABFU77_RS05045 (ABFU77_05030) | - | 1219293..1220465 (-) | 1173 | WP_181920810.1 | glycosyltransferase | - |
| ABFU77_RS05050 (ABFU77_05035) | - | 1220450..1221313 (-) | 864 | WP_116921534.1 | glycosyltransferase | - |
| ABFU77_RS05055 (ABFU77_05040) | - | 1221363..1222214 (-) | 852 | WP_108133901.1 | glycosyltransferase family 2 protein | - |
| ABFU77_RS05060 (ABFU77_05045) | pilB | 1222370..1224106 (+) | 1737 | WP_040940802.1 | type IV-A pilus assembly ATPase PilB | Machinery gene |
| ABFU77_RS05065 (ABFU77_05050) | pilR | 1225491..1226885 (-) | 1395 | WP_012437607.1 | sigma-54 dependent transcriptional regulator | Regulator |
| ABFU77_RS05070 (ABFU77_05055) | - | 1227094..1228704 (-) | 1611 | WP_323534159.1 | HAMP domain-containing sensor histidine kinase | - |
| ABFU77_RS05075 (ABFU77_05060) | sucC | 1228938..1230107 (+) | 1170 | WP_011038209.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| ABFU77_RS05080 (ABFU77_05065) | sucD | 1230132..1231007 (+) | 876 | WP_011038208.1 | succinate--CoA ligase subunit alpha | - |
| ABFU77_RS05085 (ABFU77_05070) | - | 1231144..1231521 (+) | 378 | WP_323534162.1 | DNA-binding protein | - |
| ABFU77_RS05090 (ABFU77_05075) | - | 1231525..1231827 (+) | 303 | WP_011038207.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Sequence
Protein
Download Length: 132 a.a. Molecular weight: 13656.88 Da Isoelectric Point: 8.8372
>NTDB_id=1000512 ABFU77_RS05015 WP_104570927.1 1213589..1213987(+) (pilA/pilAI) [Xanthomonas campestris pv. raphani strain bglFP 6790]
MKKQQGFTLIELMIVVAIIAILAAIALPMYQDYVAKSQATAGLAEITPGKTQYEVLVNEGTVPTTAAQIGLTTPTARCAV
VVSTSGITCTLNGNANKIKGKTISLNRSSADGTWSCVTGGTMDAKYKPAGCS
MKKQQGFTLIELMIVVAIIAILAAIALPMYQDYVAKSQATAGLAEITPGKTQYEVLVNEGTVPTTAAQIGLTTPTARCAV
VVSTSGITCTLNGNANKIKGKTISLNRSSADGTWSCVTGGTMDAKYKPAGCS
Nucleotide
Download Length: 399 bp
>NTDB_id=1000512 ABFU77_RS05015 WP_104570927.1 1213589..1213987(+) (pilA/pilAI) [Xanthomonas campestris pv. raphani strain bglFP 6790]
ATGAAGAAGCAGCAAGGCTTTACGCTGATCGAACTGATGATCGTAGTCGCGATCATCGCCATCCTGGCCGCCATTGCGCT
ACCGATGTATCAGGACTATGTTGCCAAGTCGCAGGCGACTGCCGGTCTGGCAGAAATCACTCCTGGCAAGACGCAGTATG
AAGTGTTGGTCAACGAAGGTACTGTTCCTACGACGGCCGCCCAGATTGGCTTGACAACGCCGACTGCGCGTTGCGCTGTT
GTCGTAAGCACCTCTGGCATTACATGCACCTTGAATGGCAACGCGAACAAGATTAAAGGCAAAACCATTAGCCTTAACCG
TAGTTCCGCAGATGGTACTTGGAGCTGTGTAACTGGCGGCACCATGGACGCGAAATACAAGCCCGCCGGCTGTTCCTGA
ATGAAGAAGCAGCAAGGCTTTACGCTGATCGAACTGATGATCGTAGTCGCGATCATCGCCATCCTGGCCGCCATTGCGCT
ACCGATGTATCAGGACTATGTTGCCAAGTCGCAGGCGACTGCCGGTCTGGCAGAAATCACTCCTGGCAAGACGCAGTATG
AAGTGTTGGTCAACGAAGGTACTGTTCCTACGACGGCCGCCCAGATTGGCTTGACAACGCCGACTGCGCGTTGCGCTGTT
GTCGTAAGCACCTCTGGCATTACATGCACCTTGAATGGCAACGCGAACAAGATTAAAGGCAAAACCATTAGCCTTAACCG
TAGTTCCGCAGATGGTACTTGGAGCTGTGTAACTGGCGGCACCATGGACGCGAAATACAAGCCCGCCGGCTGTTCCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilA/pilAI | Pseudomonas stutzeri DSM 10701 |
58.394 |
100 |
0.606 |
| pilA | Acinetobacter baumannii strain A118 |
51.064 |
100 |
0.545 |
| pilA/pilAII | Pseudomonas stutzeri DSM 10701 |
46.667 |
100 |
0.477 |
| pilA | Pseudomonas aeruginosa PAK |
41.06 |
100 |
0.47 |
| pilA2 | Legionella pneumophila strain ERS1305867 |
43.066 |
100 |
0.447 |
| pilA2 | Legionella pneumophila str. Paris |
43.066 |
100 |
0.447 |
| comP | Acinetobacter baylyi ADP1 |
39.456 |
100 |
0.439 |
| pilA | Vibrio cholerae strain A1552 |
39.583 |
100 |
0.432 |
| pilA | Vibrio cholerae C6706 |
39.583 |
100 |
0.432 |
| pilA | Vibrio cholerae O1 biovar El Tor strain E7946 |
39.583 |
100 |
0.432 |
| pilA/pilA1 | Eikenella corrodens VA1 |
36.242 |
100 |
0.409 |
| pilE | Neisseria gonorrhoeae MS11 |
34.416 |
100 |
0.402 |
| pilA | Vibrio parahaemolyticus RIMD 2210633 |
41.6 |
94.697 |
0.394 |
| pilA | Haemophilus influenzae Rd KW20 |
38.346 |
100 |
0.386 |