Detailed information
Bioinformatically predicted
Overview
| Name | pilA2 | Type | Machinery gene |
| Locus tag | ABFU20_RS16160 | Genome accession | NZ_CP155963 |
| Coordinates | 3653660..3654091 (-) | Length | 143 a.a. |
| NCBI ID | WP_043922199.1 | Uniprot ID | - |
| Organism | Xanthomonas campestris pv. raphani strain BR66 | ||
| Function | assembly of type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 3649397..3702313 | 3653660..3654091 | within | 0 |
| IScluster/Tn | 3647977..3653563 | 3653660..3654091 | flank | 97 |
Gene organization within MGE regions
Location: 3647977..3702313
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABFU20_RS16135 (ABFU20_16090) | - | 3647977..3649079 (+) | 1103 | WP_148263038.1 | IS3 family transposase | - |
| ABFU20_RS16140 (ABFU20_16095) | - | 3649298..3649660 (+) | 363 | WP_148263072.1 | hypothetical protein | - |
| ABFU20_RS16145 (ABFU20_16100) | - | 3649605..3650396 (+) | 792 | WP_202796265.1 | toxin | - |
| ABFU20_RS16150 (ABFU20_16105) | pilB | 3650579..3652315 (-) | 1737 | WP_043921911.1 | type IV-A pilus assembly ATPase PilB | Machinery gene |
| ABFU20_RS16160 (ABFU20_16115) | pilA2 | 3653660..3654091 (-) | 432 | WP_043922199.1 | pilin | Machinery gene |
| ABFU20_RS16165 (ABFU20_16120) | - | 3654440..3655697 (+) | 1258 | Protein_3126 | type II secretion system F family protein | - |
| ABFU20_RS16170 (ABFU20_16125) | - | 3655704..3656567 (+) | 864 | WP_011038216.1 | A24 family peptidase | - |
| ABFU20_RS16175 (ABFU20_16130) | coaE | 3656581..3657204 (+) | 624 | WP_014508710.1 | dephospho-CoA kinase | - |
| ABFU20_RS16180 (ABFU20_16135) | - | 3657736..3658137 (+) | 402 | WP_043921912.1 | SymE family type I addiction module toxin | - |
| ABFU20_RS16185 (ABFU20_16140) | - | 3658212..3658502 (+) | 291 | WP_014508712.1 | DUF1778 domain-containing protein | - |
| ABFU20_RS16190 (ABFU20_16145) | - | 3658499..3658990 (+) | 492 | WP_014508713.1 | GNAT family N-acetyltransferase | - |
| ABFU20_RS16195 (ABFU20_16150) | - | 3659133..3660467 (-) | 1335 | WP_012437598.1 | HAMP domain-containing sensor histidine kinase | - |
| ABFU20_RS16200 (ABFU20_16155) | - | 3660460..3661137 (-) | 678 | WP_003490678.1 | response regulator transcription factor | - |
| ABFU20_RS16205 (ABFU20_16160) | rimK | 3661787..3662662 (-) | 876 | WP_043921913.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
| ABFU20_RS16210 (ABFU20_16165) | glgX | 3663155..3665284 (+) | 2130 | WP_014508716.1 | glycogen debranching protein GlgX | - |
| ABFU20_RS16215 (ABFU20_16170) | - | 3665826..3666218 (-) | 393 | WP_011038224.1 | H-NS family nucleoid-associated regulatory protein | - |
| ABFU20_RS16220 (ABFU20_16175) | - | 3666309..3666704 (-) | 396 | WP_042594933.1 | hypothetical protein | - |
| ABFU20_RS16225 (ABFU20_16180) | - | 3666880..3667035 (-) | 156 | WP_042594934.1 | hypothetical protein | - |
| ABFU20_RS16230 (ABFU20_16185) | - | 3667153..3667494 (-) | 342 | WP_237704751.1 | hypothetical protein | - |
| ABFU20_RS16235 (ABFU20_16190) | - | 3667627..3667998 (-) | 372 | WP_014508721.1 | hypothetical protein | - |
| ABFU20_RS16240 (ABFU20_16195) | - | 3668681..3669022 (+) | 342 | WP_080565911.1 | hypothetical protein | - |
| ABFU20_RS16245 (ABFU20_16200) | - | 3669075..3670685 (-) | 1611 | WP_014508722.1 | MobA/MobL family protein | - |
| ABFU20_RS16250 (ABFU20_16205) | - | 3670953..3671279 (+) | 327 | WP_043921914.1 | conjugal transfer protein TraD | - |
| ABFU20_RS16255 (ABFU20_16210) | - | 3671542..3671811 (+) | 270 | WP_237704833.1 | HNH endonuclease | - |
| ABFU20_RS16260 (ABFU20_16215) | - | 3671805..3672362 (+) | 558 | WP_014508723.1 | hypothetical protein | - |
| ABFU20_RS16265 (ABFU20_16220) | - | 3672410..3673645 (+) | 1236 | WP_237704752.1 | HNH endonuclease | - |
| ABFU20_RS16270 (ABFU20_16225) | - | 3673657..3674283 (-) | 627 | WP_162470855.1 | hypothetical protein | - |
| ABFU20_RS16275 (ABFU20_16230) | - | 3674348..3678313 (-) | 3966 | WP_014508726.1 | hypothetical protein | - |
| ABFU20_RS16280 (ABFU20_16235) | - | 3678351..3678989 (-) | 639 | WP_043921915.1 | DUF1629 domain-containing protein | - |
| ABFU20_RS16285 (ABFU20_16240) | - | 3679122..3680486 (-) | 1365 | WP_014508728.1 | DNA double-strand break repair nuclease NurA | - |
| ABFU20_RS16290 (ABFU20_16245) | - | 3680489..3682579 (-) | 2091 | WP_014508729.1 | ATP-binding protein | - |
| ABFU20_RS16295 (ABFU20_16250) | - | 3682593..3683483 (-) | 891 | WP_033836759.1 | DNA adenine methylase | - |
| ABFU20_RS16300 (ABFU20_16255) | - | 3683701..3683892 (-) | 192 | WP_080565913.1 | hypothetical protein | - |
| ABFU20_RS16305 (ABFU20_16260) | - | 3683962..3684441 (-) | 480 | WP_014508730.1 | RadC family protein | - |
| ABFU20_RS16310 (ABFU20_16265) | - | 3684844..3685068 (-) | 225 | WP_039405436.1 | hypothetical protein | - |
| ABFU20_RS16315 (ABFU20_16270) | - | 3685262..3685708 (+) | 447 | WP_014508731.1 | hypothetical protein | - |
| ABFU20_RS16320 (ABFU20_16275) | - | 3686284..3687684 (+) | 1401 | WP_014508732.1 | site-specific integrase | - |
| ABFU20_RS16325 (ABFU20_16280) | - | 3688036..3689451 (+) | 1416 | WP_014508733.1 | hypothetical protein | - |
| ABFU20_RS16330 (ABFU20_16285) | - | 3689452..3690687 (-) | 1236 | WP_202796266.1 | abortive infection family protein | - |
| ABFU20_RS16335 (ABFU20_16290) | - | 3690732..3691925 (-) | 1194 | WP_014508735.1 | GIY-YIG nuclease family protein | - |
| ABFU20_RS16340 (ABFU20_16295) | - | 3691918..3694023 (-) | 2106 | WP_043921917.1 | DEAD/DEAH box helicase | - |
| ABFU20_RS16345 (ABFU20_16300) | - | 3694020..3696806 (-) | 2787 | WP_043921918.1 | DNA methyltransferase | - |
| ABFU20_RS16350 (ABFU20_16305) | - | 3697144..3697467 (-) | 324 | WP_108723645.1 | helix-turn-helix domain-containing protein | - |
| ABFU20_RS16355 (ABFU20_16310) | - | 3697572..3698324 (+) | 753 | WP_014508739.1 | hypothetical protein | - |
| ABFU20_RS16360 (ABFU20_16315) | - | 3698367..3698681 (+) | 315 | WP_014508740.1 | hypothetical protein | - |
| ABFU20_RS16365 (ABFU20_16320) | - | 3698678..3699058 (+) | 381 | WP_193387299.1 | hypothetical protein | - |
| ABFU20_RS16370 (ABFU20_16325) | - | 3699317..3700315 (-) | 999 | WP_148263074.1 | hypothetical protein | - |
| ABFU20_RS16375 (ABFU20_16330) | - | 3700352..3700534 (-) | 183 | WP_141762696.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 143 a.a. Molecular weight: 14758.07 Da Isoelectric Point: 9.0331
>NTDB_id=1000366 ABFU20_RS16160 WP_043922199.1 3653660..3654091(-) (pilA2) [Xanthomonas campestris pv. raphani strain BR66]
MKKQQGFTLIELMIVIAIIAILAAIALPAYQDYTIRSKVSETMIAMSAAKLAVAETAQSQGILATAVTNNTAAGYSGQTT
DKVASVVIANGVVTGTSKNTGAKVEPILKLTPTQADKDSPITWACSYTAGEAKHVPASCRTAG
MKKQQGFTLIELMIVIAIIAILAAIALPAYQDYTIRSKVSETMIAMSAAKLAVAETAQSQGILATAVTNNTAAGYSGQTT
DKVASVVIANGVVTGTSKNTGAKVEPILKLTPTQADKDSPITWACSYTAGEAKHVPASCRTAG
Nucleotide
Download Length: 432 bp
>NTDB_id=1000366 ABFU20_RS16160 WP_043922199.1 3653660..3654091(-) (pilA2) [Xanthomonas campestris pv. raphani strain BR66]
ATGAAAAAGCAGCAAGGTTTTACTCTTATTGAATTGATGATTGTTATTGCCATCATCGCGATCCTAGCCGCCATTGCTCT
TCCGGCATATCAGGATTACACCATTCGAAGCAAAGTCAGCGAAACCATGATTGCTATGTCTGCAGCTAAGCTAGCGGTAG
CTGAGACTGCCCAGTCTCAAGGTATTCTGGCAACTGCCGTTACTAACAACACCGCCGCTGGATACTCCGGGCAAACTACC
GATAAGGTAGCGAGCGTGGTCATTGCCAATGGTGTGGTCACCGGTACTTCCAAGAACACTGGCGCAAAAGTTGAGCCGAT
CTTGAAGCTTACCCCCACGCAGGCTGATAAAGACTCGCCGATTACATGGGCTTGCAGCTACACCGCTGGTGAAGCTAAGC
ATGTCCCGGCAAGCTGCCGTACCGCTGGCTGA
ATGAAAAAGCAGCAAGGTTTTACTCTTATTGAATTGATGATTGTTATTGCCATCATCGCGATCCTAGCCGCCATTGCTCT
TCCGGCATATCAGGATTACACCATTCGAAGCAAAGTCAGCGAAACCATGATTGCTATGTCTGCAGCTAAGCTAGCGGTAG
CTGAGACTGCCCAGTCTCAAGGTATTCTGGCAACTGCCGTTACTAACAACACCGCCGCTGGATACTCCGGGCAAACTACC
GATAAGGTAGCGAGCGTGGTCATTGCCAATGGTGTGGTCACCGGTACTTCCAAGAACACTGGCGCAAAAGTTGAGCCGAT
CTTGAAGCTTACCCCCACGCAGGCTGATAAAGACTCGCCGATTACATGGGCTTGCAGCTACACCGCTGGTGAAGCTAAGC
ATGTCCCGGCAAGCTGCCGTACCGCTGGCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilA2 | Legionella pneumophila str. Paris |
51.02 |
100 |
0.524 |
| pilA2 | Legionella pneumophila strain ERS1305867 |
50.34 |
100 |
0.517 |
| pilE | Neisseria elongata subsp. glycolytica ATCC 29315 |
38.378 |
100 |
0.496 |
| comP | Acinetobacter baylyi ADP1 |
42.767 |
100 |
0.476 |
| pilE | Neisseria gonorrhoeae strain FA1090 |
40.764 |
100 |
0.448 |
| pilA | Ralstonia pseudosolanacearum GMI1000 |
37.952 |
100 |
0.441 |
| pilE | Neisseria gonorrhoeae MS11 |
39.873 |
100 |
0.441 |
| pilA/pilAI | Pseudomonas stutzeri DSM 10701 |
40.559 |
100 |
0.406 |
| pilA | Haemophilus influenzae 86-028NP |
39.716 |
98.601 |
0.392 |
| pilA | Haemophilus influenzae Rd KW20 |
38.462 |
100 |
0.385 |
| pilA/pilA1 | Eikenella corrodens VA1 |
36 |
100 |
0.378 |
| pilA | Vibrio cholerae C6706 |
35.811 |
100 |
0.371 |
| pilA | Vibrio cholerae strain A1552 |
35.811 |
100 |
0.371 |
| pilA | Vibrio cholerae O1 biovar El Tor strain E7946 |
35.811 |
100 |
0.371 |