Detailed information
Overview
| Name | pilA/pilAI | Type | Machinery gene |
| Locus tag | ABFU45_RS05070 | Genome accession | NZ_CP155958 |
| Coordinates | 1220686..1221084 (+) | Length | 132 a.a. |
| NCBI ID | WP_407472941.1 | Uniprot ID | - |
| Organism | Xanthomonas campestris pv. raphani strain bglFP 6806 | ||
| Function | assembly of type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 1207671..1238924 | 1220686..1221084 | within | 0 |
Gene organization within MGE regions
Location: 1207671..1238924
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABFU45_RS05000 (ABFU45_04995) | - | 1207671..1207817 (+) | 147 | WP_116889157.1 | hypothetical protein | - |
| ABFU45_RS05005 (ABFU45_05000) | - | 1208002..1208397 (+) | 396 | WP_011038225.1 | hypothetical protein | - |
| ABFU45_RS05010 (ABFU45_05005) | - | 1208488..1208880 (+) | 393 | WP_011038224.1 | H-NS family nucleoid-associated regulatory protein | - |
| ABFU45_RS05015 (ABFU45_05010) | glgX | 1209406..1211535 (-) | 2130 | WP_228943906.1 | glycogen debranching protein GlgX | - |
| ABFU45_RS05020 (ABFU45_05015) | rimK | 1212031..1212906 (+) | 876 | WP_076054142.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
| ABFU45_RS05025 (ABFU45_05020) | - | 1213129..1213602 (+) | 474 | WP_012437597.1 | hypothetical protein | - |
| ABFU45_RS05030 (ABFU45_05025) | - | 1213633..1214310 (+) | 678 | WP_003490678.1 | response regulator transcription factor | - |
| ABFU45_RS05035 (ABFU45_05030) | - | 1214303..1215637 (+) | 1335 | WP_012437598.1 | HAMP domain-containing sensor histidine kinase | - |
| ABFU45_RS05040 (ABFU45_05035) | - | 1215780..1216271 (-) | 492 | WP_323534157.1 | GNAT family N-acetyltransferase | - |
| ABFU45_RS05045 (ABFU45_05040) | - | 1216268..1216558 (-) | 291 | WP_014508712.1 | DUF1778 domain-containing protein | - |
| ABFU45_RS05050 (ABFU45_05045) | - | 1216633..1217034 (-) | 402 | WP_181921862.1 | SymE family type I addiction module toxin | - |
| ABFU45_RS05055 (ABFU45_05050) | coaE | 1217566..1218189 (-) | 624 | WP_116901791.1 | dephospho-CoA kinase | - |
| ABFU45_RS05060 (ABFU45_05055) | - | 1218203..1219066 (-) | 864 | WP_011038216.1 | A24 family peptidase | - |
| ABFU45_RS05065 (ABFU45_05060) | pilC | 1219073..1220335 (-) | 1263 | WP_104570928.1 | type II secretion system F family protein | Machinery gene |
| ABFU45_RS05070 (ABFU45_05065) | pilA/pilAI | 1220686..1221084 (+) | 399 | WP_407472941.1 | pilin | Machinery gene |
| ABFU45_RS05075 (ABFU45_05070) | - | 1221185..1221607 (+) | 423 | WP_104570926.1 | pilin | - |
| ABFU45_RS05080 (ABFU45_05075) | - | 1221666..1223486 (+) | 1821 | WP_147308815.1 | hypothetical protein | - |
| ABFU45_RS05085 (ABFU45_05080) | - | 1223610..1224368 (+) | 759 | WP_323534158.1 | class I SAM-dependent methyltransferase | - |
| ABFU45_RS05090 (ABFU45_05085) | - | 1224865..1225551 (+) | 687 | WP_258872788.1 | glycosyltransferase family 9 protein | - |
| ABFU45_RS05095 (ABFU45_05090) | - | 1225554..1226396 (-) | 843 | WP_147308817.1 | glycosyltransferase | - |
| ABFU45_RS05100 (ABFU45_05095) | - | 1226390..1227562 (-) | 1173 | WP_181920810.1 | glycosyltransferase | - |
| ABFU45_RS05105 (ABFU45_05100) | - | 1227547..1228410 (-) | 864 | WP_116921534.1 | glycosyltransferase | - |
| ABFU45_RS05110 (ABFU45_05105) | - | 1228460..1229311 (-) | 852 | WP_108133901.1 | glycosyltransferase family 2 protein | - |
| ABFU45_RS05115 (ABFU45_05110) | pilB | 1229467..1231203 (+) | 1737 | WP_040940802.1 | type IV-A pilus assembly ATPase PilB | Machinery gene |
| ABFU45_RS05120 (ABFU45_05115) | pilR | 1232588..1233982 (-) | 1395 | WP_012437607.1 | sigma-54 dependent transcriptional regulator | Regulator |
| ABFU45_RS05125 (ABFU45_05120) | - | 1234191..1235801 (-) | 1611 | WP_323534159.1 | HAMP domain-containing sensor histidine kinase | - |
| ABFU45_RS05130 (ABFU45_05125) | sucC | 1236035..1237204 (+) | 1170 | WP_011038209.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| ABFU45_RS05135 (ABFU45_05130) | sucD | 1237229..1238104 (+) | 876 | WP_011038208.1 | succinate--CoA ligase subunit alpha | - |
| ABFU45_RS05140 (ABFU45_05135) | - | 1238241..1238618 (+) | 378 | WP_323534162.1 | DNA-binding protein | - |
| ABFU45_RS05145 (ABFU45_05140) | - | 1238622..1238924 (+) | 303 | WP_011038207.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Sequence
Protein
Download Length: 132 a.a. Molecular weight: 13684.93 Da Isoelectric Point: 8.8372
>NTDB_id=1000265 ABFU45_RS05070 WP_407472941.1 1220686..1221084(+) (pilA/pilAI) [Xanthomonas campestris pv. raphani strain bglFP 6806]
MKKQQGFTLIELMIVVAIIAILAAIALPMYQDYVAKSQATAGLAEITPGKTQYEVLVNEGTVPTTVAQIGLTTPTARCAV
VVSTSGITCTLNGNANKIKGKTISLNRSSADGTWSCVTGGTMDAKYKPAGCS
MKKQQGFTLIELMIVVAIIAILAAIALPMYQDYVAKSQATAGLAEITPGKTQYEVLVNEGTVPTTVAQIGLTTPTARCAV
VVSTSGITCTLNGNANKIKGKTISLNRSSADGTWSCVTGGTMDAKYKPAGCS
Nucleotide
Download Length: 399 bp
>NTDB_id=1000265 ABFU45_RS05070 WP_407472941.1 1220686..1221084(+) (pilA/pilAI) [Xanthomonas campestris pv. raphani strain bglFP 6806]
ATGAAGAAGCAGCAAGGCTTTACGCTGATCGAACTGATGATCGTAGTCGCGATCATCGCCATCCTGGCCGCCATTGCGCT
ACCGATGTATCAGGACTATGTTGCCAAGTCGCAGGCGACTGCCGGTCTGGCAGAAATCACTCCTGGCAAGACGCAGTATG
AAGTGTTGGTCAACGAAGGTACTGTTCCTACGACGGTCGCCCAGATTGGCTTGACAACGCCGACTGCGCGTTGCGCTGTT
GTCGTAAGCACCTCTGGCATTACATGCACCTTGAATGGCAACGCGAACAAGATTAAAGGCAAAACCATTAGCCTTAACCG
TAGTTCCGCAGATGGTACTTGGAGCTGTGTAACTGGCGGCACCATGGACGCGAAATACAAGCCCGCCGGCTGTTCCTGA
ATGAAGAAGCAGCAAGGCTTTACGCTGATCGAACTGATGATCGTAGTCGCGATCATCGCCATCCTGGCCGCCATTGCGCT
ACCGATGTATCAGGACTATGTTGCCAAGTCGCAGGCGACTGCCGGTCTGGCAGAAATCACTCCTGGCAAGACGCAGTATG
AAGTGTTGGTCAACGAAGGTACTGTTCCTACGACGGTCGCCCAGATTGGCTTGACAACGCCGACTGCGCGTTGCGCTGTT
GTCGTAAGCACCTCTGGCATTACATGCACCTTGAATGGCAACGCGAACAAGATTAAAGGCAAAACCATTAGCCTTAACCG
TAGTTCCGCAGATGGTACTTGGAGCTGTGTAACTGGCGGCACCATGGACGCGAAATACAAGCCCGCCGGCTGTTCCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilA/pilAI | Pseudomonas stutzeri DSM 10701 |
58.394 |
100 |
0.606 |
| pilA | Acinetobacter baumannii strain A118 |
51.064 |
100 |
0.545 |
| pilA/pilAII | Pseudomonas stutzeri DSM 10701 |
47.407 |
100 |
0.485 |
| pilA | Pseudomonas aeruginosa PAK |
41.722 |
100 |
0.477 |
| pilA2 | Legionella pneumophila strain ERS1305867 |
43.066 |
100 |
0.447 |
| pilA2 | Legionella pneumophila str. Paris |
43.066 |
100 |
0.447 |
| comP | Acinetobacter baylyi ADP1 |
39.597 |
100 |
0.447 |
| pilA | Vibrio cholerae strain A1552 |
39.583 |
100 |
0.432 |
| pilA | Vibrio cholerae C6706 |
39.583 |
100 |
0.432 |
| pilA | Vibrio cholerae O1 biovar El Tor strain E7946 |
39.583 |
100 |
0.432 |
| pilE | Neisseria gonorrhoeae MS11 |
34.416 |
100 |
0.402 |
| pilA/pilA1 | Eikenella corrodens VA1 |
35.57 |
100 |
0.402 |
| pilA | Vibrio parahaemolyticus RIMD 2210633 |
41.6 |
94.697 |
0.394 |
| pilA | Haemophilus influenzae Rd KW20 |
38.346 |
100 |
0.386 |