Detailed information
Overview
| Name | pilA/pilAI | Type | Machinery gene |
| Locus tag | ABFU60_RS05095 | Genome accession | NZ_CP155949 |
| Coordinates | 1216669..1217067 (+) | Length | 132 a.a. |
| NCBI ID | WP_104570927.1 | Uniprot ID | - |
| Organism | Xanthomonas campestris pv. raphani strain bglFP 6815 | ||
| Function | assembly of type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 1205115..1228465 | 1216669..1217067 | within | 0 |
Gene organization within MGE regions
Location: 1205115..1228465
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABFU60_RS05040 (ABFU60_05030) | - | 1205115..1205261 (+) | 147 | WP_076054137.1 | hypothetical protein | - |
| ABFU60_RS05045 (ABFU60_05035) | - | 1205445..1205840 (+) | 396 | WP_042594933.1 | hypothetical protein | - |
| ABFU60_RS05050 (ABFU60_05040) | - | 1205931..1206323 (+) | 393 | WP_011038224.1 | H-NS family nucleoid-associated regulatory protein | - |
| ABFU60_RS05055 (ABFU60_05045) | glgX | 1206849..1208978 (-) | 2130 | WP_274299339.1 | glycogen debranching protein GlgX | - |
| ABFU60_RS05060 (ABFU60_05050) | rimK | 1209472..1210347 (+) | 876 | WP_076054142.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
| ABFU60_RS05065 (ABFU60_05055) | - | 1210997..1211674 (+) | 678 | WP_003490678.1 | response regulator transcription factor | - |
| ABFU60_RS05070 (ABFU60_05060) | - | 1211667..1213001 (+) | 1335 | WP_019237347.1 | HAMP domain-containing sensor histidine kinase | - |
| ABFU60_RS05075 (ABFU60_05065) | - | 1213100..1213355 (-) | 256 | Protein_986 | SymE family type I addiction module toxin | - |
| ABFU60_RS05080 (ABFU60_05070) | coaE | 1213549..1214172 (-) | 624 | WP_225042504.1 | dephospho-CoA kinase | - |
| ABFU60_RS05085 (ABFU60_05075) | - | 1214186..1215049 (-) | 864 | WP_011038216.1 | A24 family peptidase | - |
| ABFU60_RS05090 (ABFU60_05080) | pilC | 1215056..1216318 (-) | 1263 | WP_104570928.1 | type II secretion system F family protein | Machinery gene |
| ABFU60_RS05095 (ABFU60_05085) | pilA/pilAI | 1216669..1217067 (+) | 399 | WP_104570927.1 | pilin | Machinery gene |
| ABFU60_RS05100 (ABFU60_05090) | - | 1217168..1217590 (+) | 423 | WP_104570926.1 | pilin | - |
| ABFU60_RS05105 (ABFU60_05095) | - | 1217649..1219469 (+) | 1821 | WP_147308815.1 | hypothetical protein | - |
| ABFU60_RS05110 (ABFU60_05100) | - | 1219593..1220351 (+) | 759 | WP_274299340.1 | bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG | - |
| ABFU60_RS05115 (ABFU60_05105) | - | 1220848..1221534 (+) | 687 | WP_258872788.1 | glycosyltransferase family 9 protein | - |
| ABFU60_RS05120 (ABFU60_05110) | - | 1221537..1222379 (-) | 843 | WP_147308817.1 | glycosyltransferase | - |
| ABFU60_RS05125 (ABFU60_05115) | - | 1222373..1223545 (-) | 1173 | WP_181920810.1 | glycosyltransferase | - |
| ABFU60_RS05130 (ABFU60_05120) | - | 1223530..1224393 (-) | 864 | WP_116921534.1 | glycosyltransferase | - |
| ABFU60_RS05135 (ABFU60_05125) | - | 1224443..1225294 (-) | 852 | WP_108133901.1 | glycosyltransferase family 2 protein | - |
| ABFU60_RS05140 (ABFU60_05130) | pilB | 1225450..1227183 (+) | 1734 | WP_274299341.1 | type IV-A pilus assembly ATPase PilB | Machinery gene |
| ABFU60_RS05145 (ABFU60_05135) | - | 1227366..1228103 (-) | 738 | WP_274299342.1 | zeta toxin family protein | - |
| ABFU60_RS05150 (ABFU60_05140) | - | 1228103..1228459 (-) | 357 | WP_139328384.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 132 a.a. Molecular weight: 13656.88 Da Isoelectric Point: 8.8372
>NTDB_id=1000110 ABFU60_RS05095 WP_104570927.1 1216669..1217067(+) (pilA/pilAI) [Xanthomonas campestris pv. raphani strain bglFP 6815]
MKKQQGFTLIELMIVVAIIAILAAIALPMYQDYVAKSQATAGLAEITPGKTQYEVLVNEGTVPTTAAQIGLTTPTARCAV
VVSTSGITCTLNGNANKIKGKTISLNRSSADGTWSCVTGGTMDAKYKPAGCS
MKKQQGFTLIELMIVVAIIAILAAIALPMYQDYVAKSQATAGLAEITPGKTQYEVLVNEGTVPTTAAQIGLTTPTARCAV
VVSTSGITCTLNGNANKIKGKTISLNRSSADGTWSCVTGGTMDAKYKPAGCS
Nucleotide
Download Length: 399 bp
>NTDB_id=1000110 ABFU60_RS05095 WP_104570927.1 1216669..1217067(+) (pilA/pilAI) [Xanthomonas campestris pv. raphani strain bglFP 6815]
ATGAAGAAGCAGCAAGGCTTTACGCTGATCGAACTGATGATCGTAGTCGCGATCATCGCCATCCTGGCCGCCATTGCGCT
ACCGATGTATCAGGACTATGTTGCCAAGTCGCAGGCGACTGCCGGTCTGGCAGAAATCACTCCTGGCAAGACGCAGTATG
AAGTGTTGGTCAACGAAGGTACTGTTCCTACGACGGCCGCCCAGATTGGCTTGACAACGCCGACTGCGCGTTGCGCTGTT
GTCGTAAGCACCTCTGGCATTACATGCACCTTGAATGGCAACGCGAACAAGATTAAAGGCAAAACCATTAGCCTTAACCG
TAGTTCCGCAGATGGTACTTGGAGCTGTGTAACTGGCGGCACCATGGACGCGAAATACAAGCCCGCCGGCTGTTCCTGA
ATGAAGAAGCAGCAAGGCTTTACGCTGATCGAACTGATGATCGTAGTCGCGATCATCGCCATCCTGGCCGCCATTGCGCT
ACCGATGTATCAGGACTATGTTGCCAAGTCGCAGGCGACTGCCGGTCTGGCAGAAATCACTCCTGGCAAGACGCAGTATG
AAGTGTTGGTCAACGAAGGTACTGTTCCTACGACGGCCGCCCAGATTGGCTTGACAACGCCGACTGCGCGTTGCGCTGTT
GTCGTAAGCACCTCTGGCATTACATGCACCTTGAATGGCAACGCGAACAAGATTAAAGGCAAAACCATTAGCCTTAACCG
TAGTTCCGCAGATGGTACTTGGAGCTGTGTAACTGGCGGCACCATGGACGCGAAATACAAGCCCGCCGGCTGTTCCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilA/pilAI | Pseudomonas stutzeri DSM 10701 |
58.394 |
100 |
0.606 |
| pilA | Acinetobacter baumannii strain A118 |
51.064 |
100 |
0.545 |
| pilA/pilAII | Pseudomonas stutzeri DSM 10701 |
46.667 |
100 |
0.477 |
| pilA | Pseudomonas aeruginosa PAK |
41.06 |
100 |
0.47 |
| pilA2 | Legionella pneumophila strain ERS1305867 |
43.066 |
100 |
0.447 |
| pilA2 | Legionella pneumophila str. Paris |
43.066 |
100 |
0.447 |
| comP | Acinetobacter baylyi ADP1 |
39.456 |
100 |
0.439 |
| pilA | Vibrio cholerae strain A1552 |
39.583 |
100 |
0.432 |
| pilA | Vibrio cholerae C6706 |
39.583 |
100 |
0.432 |
| pilA | Vibrio cholerae O1 biovar El Tor strain E7946 |
39.583 |
100 |
0.432 |
| pilA/pilA1 | Eikenella corrodens VA1 |
36.242 |
100 |
0.409 |
| pilE | Neisseria gonorrhoeae MS11 |
34.416 |
100 |
0.402 |
| pilA | Vibrio parahaemolyticus RIMD 2210633 |
41.6 |
94.697 |
0.394 |
| pilA | Haemophilus influenzae Rd KW20 |
38.346 |
100 |
0.386 |