Detailed information of TA system TA004922

Experimentally validated

Overview

TA module

• Type: II
• Classification (family/domain): vapBC/AbrB-PIN
• Location: 1929188..1929816
• Replicon: chromosome
• Accession: NC_010278
• Organism: Actinobacillus pleuropneumoniae serovar 3 str. JL03

Toxin (Protein)

• Gene name: vapC
• Uniprot ID: -
• Locus tag: APJL_1767
• Protein ID: WP_012263372.1
• Coordinates: 1929418..1929816 (+)
• Length: 133 a.a.

Antitoxin (Protein)

• Gene name: vapB
• Uniprot ID: B0BSF9
• Locus tag: APJL_1766
• Protein ID: WP_005616131.1
• Coordinates: 1929188..1929418 (+)
• Length: 77 a.a.

Genomic Context

Location: 1926587..1928002 (1416 bp)
Type: Others
Protein ID: WP_005605761.1

Location: 1927995..1928567 (573 bp)
Type: Others
Protein ID: WP_012263371.1

Location: 1929188..1929418 (231 bp)
Type: Antitoxin
Protein ID: WP_005616131.1

Location: 1929418..1929816 (399 bp)
Type: Toxin
Protein ID: WP_012263372.1

Location: 1930614..1931264 (651 bp)
Type: Others
Protein ID: WP_012263374.1

Location: 1928940..1929080 (141 bp)
Type: Others
Protein ID: WP_005602535.1

Location: 1929952..1930368 (417 bp)
Type: Others
Protein ID: WP_012263373.1

Location: 1931337..1931996 (660 bp)
Type: Others
Protein ID: WP_005605767.1

Location: 1932310..1933632 (1323 bp)
Type: Others
Protein ID: WP_012263375.1

Location: 1933898..1934419 (522 bp)
Type: Others
Protein ID: WP_005618211.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
APJL_RS08895 (APJL_1764)	1926587..1928002	+	1416	WP_005605761.1	AAA family ATPase	-
APJL_RS08900 (APJL_1765)	1927995..1928567	+	573	WP_012263371.1	hypothetical protein	-
APJL_RS10920	1928940..1929080	-	141	WP_005602535.1	hypothetical protein	-
APJL_RS08905 (APJL_1766)	1929188..1929418	+	231	WP_005616131.1	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	Antitoxin
APJL_RS08910 (APJL_1767)	1929418..1929816	+	399	WP_012263372.1	tRNA(fMet)-specific endonuclease VapC	Toxin
APJL_RS08915 (APJL_1768)	1929952..1930368	-	417	WP_012263373.1	DUF417 family protein	-
APJL_RS08920 (APJL_1769)	1930614..1931264	+	651	WP_012263374.1	DUF2202 domain-containing protein	-
APJL_RS08925 (APJL_1770)	1931337..1931996	-	660	WP_005605767.1	hypothetical protein	-
APJL_RS08930 (APJL_1771)	1932310..1933632	-	1323	WP_012263375.1	HslU--HslV peptidase ATPase subunit	-
APJL_RS08935 (APJL_1772)	1933898..1934419	-	522	WP_005618211.1	ATP-dependent protease subunit HslV	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NZ_CP031854 Actinobacillus pleuropneumoniae strain ORG1224 Genomic island TA110379 1917281..1935308 0 View NZ_CP031859 Actinobacillus pleuropneumoniae strain HS143 Genomic island TA110403 1917117..1934880 0.001 View NZ_CP031874 Actinobacillus pleuropneumoniae strain S1421 Genomic island TA110460 1907375..1925402 0 View NZ_CP071698 Actinobacillus pleuropneumoniae strain SC1810 Genomic island TA196745 1994992..2013020 0	inside	Genomic island	-	-	1913969..1931996	18027

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• PIN domain (4-124)

Antitoxin

• SpoVT-AbrB domain (6-52)

Sequences

Toxin

Protein

• Length: 133 a.a.
• Molecular weight: 15077.34 Da
• Isoelectric Point: 7.4195

>T4922 WP_012263372.1 NC_010278:1929418-1929816 [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
MLTYMLDTNIAIYVVKRRPIEVLDKFNLNSTRLCVSSITAAELYYGAEKSQFPERNMAVIEDFLSRLTILDYTHKAATHF
GNIKAHLSKQGKIIGENDIHIAAHARSEGLVLVTNNLREFERVEGLRLDNWV

Nucleotide

• Length: 399 bp

>T4922 NC_010278:1929418-1929816 [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
ATGCTAACTTATATGCTTGATACTAACATTGCGATTTATGTGGTTAAACGCAGACCTATTGAAGTGCTGGATAAGTTTAA
TTTAAATTCTACCCGTCTTTGTGTAAGTAGTATCACTGCAGCGGAGCTGTATTATGGTGCAGAGAAAAGCCAGTTTCCGG
AACGAAATATGGCAGTAATTGAGGATTTTCTTTCTCGTTTAACGATTCTTGATTATACGCATAAGGCAGCTACTCACTTT
GGCAATATCAAAGCACATTTATCTAAGCAAGGTAAGATCATTGGCGAGAACGATATTCATATTGCCGCACATGCAAGAAG
TGAAGGACTCGTATTAGTGACCAATAACTTGCGTGAATTTGAACGTGTGGAAGGATTGCGATTAGATAATTGGGTATAG

Antitoxin

Protein

• Length: 77 a.a.
• Molecular weight: 8595.68 Da
• Isoelectric Point: 4.5358

>AT4922 WP_005616131.1 NC_010278:1929188-1929418 [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
MEASVFMTNRSQAVRLPAEVRFASDVKKLSVRVVGNERILAPINQSWDSFFLGSATVSDDFMTEREISTQAEREEL

Nucleotide

• Length: 231 bp

>AT4922 NC_010278:1929188-1929418 [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
ATGGAAGCATCAGTATTTATGACAAATCGCAGTCAAGCGGTACGATTGCCGGCAGAAGTACGTTTTGCAAGTGATGTAAA
AAAACTTTCTGTAAGAGTGGTAGGTAATGAACGTATTTTGGCACCGATTAACCAAAGTTGGGATAGCTTCTTTCTGGGGT
CGGCAACGGTAAGCGATGATTTCATGACAGAGCGTGAAATCAGCACTCAAGCCGAACGTGAGGAACTATAA

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
T1070	Haemophilus influenzae Rd KW20	78.03	100	0.78
T439	Salmonella enterica subsp. enterica serovar Typhimurium str. LT2	55.303	100	0.553
T10054	Bosea sp. PAMC 26642 strain PAMC26642	48.485	100	0.485
T3858	Dichelobacter nodosus VCS1703A	44.186	97.727	0.432
T3856	Dichelobacter nodosus VCS1703A	44.186	97.727	0.432
T10129	Haemophilus influenzae strain 69P2H1 N69P2H1_45_2	40.909	100	0.409
T1066	Haemophilus influenzae Rd KW20	40.152	100	0.402
T652	Leptospira interrogans serovar Lai str. 56601	40.769	98.485	0.402
T6112	uncultured bacterium	39.695	99.242	0.394
T10197	Klebsiella pneumoniae	38.806	100	0.394

Showing 1 to 10 of 14 rows

1025

rows per page

• ‹
• 1
• 2
• ›

Multiple sequence alignment

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
AT1070	Haemophilus influenzae Rd KW20	75	100	0.75
AT439	Salmonella enterica subsp. enterica serovar Typhimurium str. LT2	45.946	98.667	0.453
AT652	Leptospira interrogans serovar Lai str. 56601	42.667	98.684	0.421
AT10054	Bosea sp. PAMC 26642 strain PAMC26642	39.189	97.368	0.382
AT3858	Dichelobacter nodosus VCS1703A	37.838	97.368	0.368
AT3856	Dichelobacter nodosus VCS1703A	37.838	97.368	0.368
AT6112	uncultured bacterium	37.5	84.211	0.316
AT6111	uncultured bacterium	37.5	84.211	0.316
AT10033	Thermus thermophilus HB27	29.71	100	0.311

Showing 1 to 9 of 9 rows

10

rows per page

• ‹
• 1
• ›

Multiple sequence alignment

Structures

Toxin

Loading, please wait

Source	ID	Structure
No matching records found

Antitoxin

Loading, please wait

• AlphaFold DB: B0BSF9

References

(1) Chengkun Zheng et al. (2017) Identification of four type II toxin-antitoxin systems in Actinobacillus pleuropneumoniae. FEMS Microbiology Letters 364(12):10.1093/femsle/fnx126. [PubMed:28637172]


 experimental literature