Detailed information
Bioinformatically predicted
Overview
| Name | pilA | Type | Machinery gene |
| Locus tag | ABFU18_RS08315 | Genome accession | NZ_CP155930 |
| Coordinates | 1961601..1961705 (-) | Length | 34 a.a. |
| NCBI ID | WP_259739915.1 | Uniprot ID | - |
| Organism | Xanthomonas campestris pv. campestris strain CFBP 4954 | ||
| Function | assembly of type IV pilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1956601..1966705
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABFU18_RS08295 (ABFU18_08300) | - | 1959388..1959744 (+) | 357 | WP_230309684.1 | type IV pilin protein | - |
| ABFU18_RS08305 (ABFU18_08310) | - | 1959925..1960296 (-) | 372 | WP_349745497.1 | GspH/FimT family protein | - |
| ABFU18_RS08315 (ABFU18_08320) | pilA | 1961601..1961705 (-) | 105 | WP_259739915.1 | prepilin-type N-terminal cleavage/methylation domain-containing protein | Machinery gene |
| ABFU18_RS08320 (ABFU18_08325) | uvrB | 1961845..1963866 (+) | 2022 | WP_057672119.1 | excinuclease ABC subunit UvrB | - |
| ABFU18_RS08330 (ABFU18_08335) | - | 1964441..1964683 (+) | 243 | WP_011269633.1 | hypothetical protein | - |
| ABFU18_RS08335 (ABFU18_08340) | - | 1964717..1966390 (+) | 1674 | WP_011037620.1 | type IV secretory system conjugative DNA transfer family protein | - |
Sequence
Protein
Download Length: 34 a.a. Molecular weight: 3427.12 Da Isoelectric Point: 5.8607
>NTDB_id=999813 ABFU18_RS08315 WP_259739915.1 1961601..1961705(-) (pilA) [Xanthomonas campestris pv. campestris strain CFBP 4954]
MQTGPQSPAKGYTATELLIVMAVLGLLAAIALPS
MQTGPQSPAKGYTATELLIVMAVLGLLAAIALPS
Nucleotide
Download Length: 105 bp
>NTDB_id=999813 ABFU18_RS08315 WP_259739915.1 1961601..1961705(-) (pilA) [Xanthomonas campestris pv. campestris strain CFBP 4954]
ATGCAGACAGGACCTCAGTCACCCGCAAAAGGGTACACGGCAACCGAGCTACTCATCGTGATGGCAGTGCTCGGCCTGCT
TGCCGCAATTGCGCTGCCGAGCTGA
ATGCAGACAGGACCTCAGTCACCCGCAAAAGGGTACACGGCAACCGAGCTACTCATCGTGATGGCAGTGCTCGGCCTGCT
TGCCGCAATTGCGCTGCCGAGCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilA | Vibrio cholerae C6706 |
51.515 |
97.059 |
0.5 |
| pilA | Vibrio cholerae O1 biovar El Tor strain E7946 |
51.515 |
97.059 |
0.5 |
| pilA | Vibrio cholerae strain A1552 |
51.515 |
97.059 |
0.5 |
| pilA | Vibrio campbellii strain DS40M4 |
47.059 |
100 |
0.471 |
| pilA | Vibrio parahaemolyticus RIMD 2210633 |
44.118 |
100 |
0.441 |
| pilH | Neisseria gonorrhoeae MS11 |
60 |
73.529 |
0.441 |
| pilE | Neisseria gonorrhoeae MS11 |
60 |
73.529 |
0.441 |
| pilE | Neisseria gonorrhoeae strain FA1090 |
60 |
73.529 |
0.441 |
| pilA | Ralstonia pseudosolanacearum GMI1000 |
60 |
73.529 |
0.441 |
| pilA/pilA1 | Synechocystis sp. PCC 6803 |
58.333 |
70.588 |
0.412 |
| pilV | Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539 |
44.828 |
85.294 |
0.382 |
| ctsG | Campylobacter jejuni subsp. jejuni 81-176 |
54.167 |
70.588 |
0.382 |
| pilL | Neisseria gonorrhoeae MS11 |
52 |
73.529 |
0.382 |
| pilX | Neisseria meningitidis 8013 |
52 |
73.529 |
0.382 |