Detailed information
Bioinformatically predicted
Overview
| Name | pilA | Type | Machinery gene |
| Locus tag | ABFU18_RS08315 | Genome accession | NZ_CP155930 |
| Coordinates | 1961601..1961705 (-) | Length | 34 a.a. |
| NCBI ID | WP_259739915.1 | Uniprot ID | - |
| Organism | Xanthomonas campestris pv. campestris strain CFBP 4954 | ||
| Function | assembly of type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 1953408..1976399 | 1961601..1961705 | within | 0 |
| IScluster/Tn | 1960408..1961540 | 1961601..1961705 | flank | 61 |
Gene organization within MGE regions
Location: 1953408..1976399
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABFU18_RS08275 (ABFU18_08280) | pilV | 1953408..1953881 (+) | 474 | WP_011037628.1 | type IV pilus modification protein PilV | - |
| ABFU18_RS08280 (ABFU18_08285) | - | 1953885..1955039 (+) | 1155 | WP_011037627.1 | PilW family protein | - |
| ABFU18_RS08285 (ABFU18_08290) | - | 1955042..1955560 (+) | 519 | WP_011037626.1 | PilX N-terminal domain-containing pilus assembly protein | - |
| ABFU18_RS08290 (ABFU18_08295) | - | 1955573..1959301 (+) | 3729 | WP_075287462.1 | pilus assembly protein | - |
| ABFU18_RS08295 (ABFU18_08300) | - | 1959388..1959744 (+) | 357 | WP_230309684.1 | type IV pilin protein | - |
| ABFU18_RS08305 (ABFU18_08310) | - | 1959925..1960296 (-) | 372 | WP_349745497.1 | GspH/FimT family protein | - |
| ABFU18_RS08315 (ABFU18_08320) | pilA | 1961601..1961705 (-) | 105 | WP_259739915.1 | prepilin-type N-terminal cleavage/methylation domain-containing protein | Machinery gene |
| ABFU18_RS08320 (ABFU18_08325) | uvrB | 1961845..1963866 (+) | 2022 | WP_057672119.1 | excinuclease ABC subunit UvrB | - |
| ABFU18_RS08330 (ABFU18_08335) | - | 1964441..1964683 (+) | 243 | WP_011269633.1 | hypothetical protein | - |
| ABFU18_RS08335 (ABFU18_08340) | - | 1964717..1966390 (+) | 1674 | WP_011037620.1 | type IV secretory system conjugative DNA transfer family protein | - |
| ABFU18_RS08340 (ABFU18_08345) | - | 1966719..1967129 (+) | 411 | WP_068574839.1 | TcpQ domain-containing protein | - |
| ABFU18_RS08345 (ABFU18_08350) | - | 1967255..1968283 (+) | 1029 | WP_019237536.1 | virB8 family protein | - |
| ABFU18_RS08350 (ABFU18_08355) | - | 1968280..1969047 (+) | 768 | WP_011037617.1 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| ABFU18_RS08355 (ABFU18_08360) | - | 1969044..1970225 (+) | 1182 | WP_011037616.1 | TrbI/VirB10 family protein | - |
| ABFU18_RS08360 (ABFU18_08365) | virB11 | 1970240..1971280 (+) | 1041 | WP_029628928.1 | P-type DNA transfer ATPase VirB11 | - |
| ABFU18_RS08365 (ABFU18_08370) | - | 1971338..1972061 (+) | 724 | Protein_1624 | lytic transglycosylase domain-containing protein | - |
| ABFU18_RS08370 (ABFU18_08375) | - | 1972222..1972626 (+) | 405 | WP_011037613.1 | TrbC/VirB2 family protein | - |
| ABFU18_RS08375 (ABFU18_08380) | - | 1972619..1972930 (+) | 312 | WP_011037612.1 | type IV secretion system protein VirB3 | - |
| ABFU18_RS08380 (ABFU18_08385) | - | 1973038..1975491 (+) | 2454 | WP_011037611.1 | VirB4 family type IV secretion/conjugal transfer ATPase | - |
| ABFU18_RS08385 (ABFU18_08390) | - | 1975641..1976002 (-) | 362 | Protein_1628 | integrase core domain-containing protein | - |
Sequence
Protein
Download Length: 34 a.a. Molecular weight: 3427.12 Da Isoelectric Point: 5.8607
>NTDB_id=999813 ABFU18_RS08315 WP_259739915.1 1961601..1961705(-) (pilA) [Xanthomonas campestris pv. campestris strain CFBP 4954]
MQTGPQSPAKGYTATELLIVMAVLGLLAAIALPS
MQTGPQSPAKGYTATELLIVMAVLGLLAAIALPS
Nucleotide
Download Length: 105 bp
>NTDB_id=999813 ABFU18_RS08315 WP_259739915.1 1961601..1961705(-) (pilA) [Xanthomonas campestris pv. campestris strain CFBP 4954]
ATGCAGACAGGACCTCAGTCACCCGCAAAAGGGTACACGGCAACCGAGCTACTCATCGTGATGGCAGTGCTCGGCCTGCT
TGCCGCAATTGCGCTGCCGAGCTGA
ATGCAGACAGGACCTCAGTCACCCGCAAAAGGGTACACGGCAACCGAGCTACTCATCGTGATGGCAGTGCTCGGCCTGCT
TGCCGCAATTGCGCTGCCGAGCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilA | Vibrio cholerae C6706 |
51.515 |
97.059 |
0.5 |
| pilA | Vibrio cholerae O1 biovar El Tor strain E7946 |
51.515 |
97.059 |
0.5 |
| pilA | Vibrio cholerae strain A1552 |
51.515 |
97.059 |
0.5 |
| pilA | Vibrio campbellii strain DS40M4 |
47.059 |
100 |
0.471 |
| pilA | Vibrio parahaemolyticus RIMD 2210633 |
44.118 |
100 |
0.441 |
| pilH | Neisseria gonorrhoeae MS11 |
60 |
73.529 |
0.441 |
| pilE | Neisseria gonorrhoeae MS11 |
60 |
73.529 |
0.441 |
| pilE | Neisseria gonorrhoeae strain FA1090 |
60 |
73.529 |
0.441 |
| pilA | Ralstonia pseudosolanacearum GMI1000 |
60 |
73.529 |
0.441 |
| pilA/pilA1 | Synechocystis sp. PCC 6803 |
58.333 |
70.588 |
0.412 |
| pilV | Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539 |
44.828 |
85.294 |
0.382 |
| ctsG | Campylobacter jejuni subsp. jejuni 81-176 |
54.167 |
70.588 |
0.382 |
| pilL | Neisseria gonorrhoeae MS11 |
52 |
73.529 |
0.382 |
| pilX | Neisseria meningitidis 8013 |
52 |
73.529 |
0.382 |