Detailed information NTG0940610

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: V6U66_RS09935
• Genome accession: NZ_CP145864
• Coordinates: 2110429..2110755 (-)
• Length: 108 a.a.
• NCBI ID: WP_070576715.1
• Uniprot ID: -
• Organism: Streptococcus salivarius strain KSS7
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2105429..2115755

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
V6U66_RS09895 (V6U66_09875)	-	2105693..2106349 (-)	657	WP_014632546.1	CPBP family intramembrane glutamic endopeptidase	-
V6U66_RS09900 (V6U66_09880)	-	2106361..2106558 (-)	198	WP_002885716.1	helix-turn-helix transcriptional regulator	-
V6U66_RS09905 (V6U66_09885)	-	2106809..2108002 (-)	1194	WP_002885831.1	acetate kinase	-
V6U66_RS09910 (V6U66_09890)	comYH	2108059..2109015 (-)	957	WP_014632544.1	class I SAM-dependent methyltransferase	Machinery gene
V6U66_RS09915 (V6U66_09895)	comGG	2109060..2109377 (-)	318	WP_045001363.1	competence type IV pilus minor pilin ComGG	-
V6U66_RS09920 (V6U66_09900)	comYF	2109355..2109792 (-)	438	WP_410534501.1	competence type IV pilus minor pilin ComGF	Machinery gene
V6U66_RS09925 (V6U66_09905)	comGE	2109779..2110009 (-)	231	WP_013991265.1	competence type IV pilus minor pilin ComGE	-
V6U66_RS09930 (V6U66_09910)	comYD	2110041..2110469 (-)	429	WP_014632541.1	competence type IV pilus minor pilin ComGD	Machinery gene
V6U66_RS09935 (V6U66_09915)	comYC	2110429..2110755 (-)	327	WP_070576715.1	competence type IV pilus major pilin ComGC	Machinery gene
V6U66_RS09940 (V6U66_09920)	comYB	2110752..2111852 (-)	1101	WP_155214000.1	competence type IV pilus assembly protein ComGB	Machinery gene
V6U66_RS09945 (V6U66_09925)	comYA	2111734..2112675 (-)	942	WP_155214001.1	competence type IV pilus ATPase ComGA	Machinery gene
V6U66_RS09950 (V6U66_09930)	-	2112755..2113117 (-)	363	WP_002887019.1	DUF1033 family protein	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 11966.05 Da
• Isoelectric Point: 9.9219

>NTDB_id=940610 V6U66_RS09935 WP_070576715.1 2110429..2110755(-) (comYC) [Streptococcus salivarius strain KSS7]
MKMMFKKLNAVKLRAFTLIEMLVVLLIISILLLLFVPNLSKQKDSVKETGNAAVVKVVDSQAELYEMKNNKTASLAALVS
EGQITQKQADSYNDYYAKHGGESRSVAN

Nucleotide

• Length: 327 bp

>NTDB_id=940610 V6U66_RS09935 WP_070576715.1 2110429..2110755(-) (comYC) [Streptococcus salivarius strain KSS7]
ATGAAAATGATGTTTAAAAAATTGAATGCCGTTAAACTACGAGCTTTTACGTTAATTGAAATGCTGGTCGTGCTTCTCAT
TATCAGTATTCTCCTTTTGCTCTTTGTACCTAACTTGAGCAAGCAGAAGGATTCTGTTAAAGAGACTGGAAATGCGGCTG
TGGTCAAGGTCGTGGATTCTCAAGCAGAACTTTATGAAATGAAGAATAATAAGACAGCTAGCTTAGCTGCTCTTGTTTCA
GAAGGTCAAATCACGCAAAAACAGGCAGATTCATACAATGATTATTATGCGAAACATGGTGGCGAAAGCCGCTCAGTGGC
CAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (14-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus mutans UA140	69.231	96.296	0.667
comYC	Streptococcus mutans UA159	69.231	96.296	0.667
comYC	Streptococcus gordonii str. Challis substr. CH1	65.049	95.37	0.62
comGC/cglC	Streptococcus mitis SK321	62.264	98.148	0.611
comGC/cglC	Streptococcus mitis NCTC 12261	58.333	100	0.583
comGC/cglC	Streptococcus pneumoniae D39	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae R6	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae Rx1	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae TIGR4	58.491	98.148	0.574
comGC	Lactococcus lactis subsp. cremoris KW2	56.604	98.148	0.556
comYC	Streptococcus suis isolate S10	60.227	81.481	0.491
comGC	Staphylococcus aureus MW2	50	79.63	0.398
comGC	Staphylococcus aureus N315	50	79.63	0.398