NTDB

Overview

Name	comYC	Type	Machinery gene
Locus tag	V6U62_RS00770	Genome accession	NZ_CP145860
Coordinates	149676..150002 (+)	Length	108 a.a.
NCBI ID	WP_002885815.1	Uniprot ID	-
Organism	Streptococcus salivarius strain KSS2
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 144676..155002

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
V6U62_RS00755 (V6U62_00750)	-	147312..147674 (+)	363	WP_002887019.1	DUF1033 family protein	-
V6U62_RS00760 (V6U62_00755)	comYA	147756..148697 (+)	942	WP_002885658.1	competence type IV pilus ATPase ComGA	Machinery gene
V6U62_RS00765 (V6U62_00760)	comYB	148579..149679 (+)	1101	WP_144429890.1	competence type IV pilus assembly protein ComGB	Machinery gene
V6U62_RS00770 (V6U62_00765)	comYC	149676..150002 (+)	327	WP_002885815.1	competence type IV pilus major pilin ComGC	Machinery gene
V6U62_RS00775 (V6U62_00770)	comYD	149962..150390 (+)	429	WP_253183813.1	competence type IV pilus minor pilin ComGD	Machinery gene
V6U62_RS00780 (V6U62_00775)	comGE	150422..150652 (+)	231	WP_021144685.1	competence type IV pilus minor pilin ComGE	-
V6U62_RS00785 (V6U62_00780)	comYF	150639..151076 (+)	438	WP_227071977.1	competence type IV pilus minor pilin ComGF	Machinery gene
V6U62_RS00790 (V6U62_00785)	comGG	151054..151371 (+)	318	WP_227071976.1	competence type IV pilus minor pilin ComGG	-
V6U62_RS00795 (V6U62_00790)	comYH	151416..152372 (+)	957	WP_227071975.1	class I SAM-dependent methyltransferase	Machinery gene
V6U62_RS00800 (V6U62_00795)	-	152429..153622 (+)	1194	WP_410535066.1	acetate kinase	-
V6U62_RS00805 (V6U62_00800)	-	153873..154070 (+)	198	WP_002885716.1	helix-turn-helix transcriptional regulator	-
V6U62_RS00810 (V6U62_00805)	-	154082..154738 (+)	657	WP_410535064.1	CPBP family intramembrane glutamic endopeptidase	-

Sequence

Protein

Download Length: 108 a.a. Molecular weight: 11932.03 Da Isoelectric Point: 9.9219

                                >NTDB_id=940286 V6U62_RS00770 WP_002885815.1 149676..150002(+) (comYC) [Streptococcus salivarius strain KSS2]

MKMMLKKLNAVKLRAFTLIEMLVVLLIISILLLLFVPNLSKQKDSVKETGNAAVVKVVDSQAELYEMKNNKTASLAALVS

EGQITQKQADSYNDYYAKHGGESRSVAN

Nucleotide

Download Length: 327 bp

                                >NTDB_id=940286 V6U62_RS00770 WP_002885815.1 149676..150002(+) (comYC) [Streptococcus salivarius strain KSS2]

ATGAAAATGATGTTAAAAAAATTGAATGCCGTTAAACTACGAGCTTTTACACTAATCGAAATGCTGGTCGTGCTTCTCAT

TATCAGTATTCTCCTTTTGCTCTTTGTACCTAACTTGAGCAAGCAGAAGGATTCTGTTAAAGAGACTGGAAATGCGGCTG

TGGTCAAGGTCGTGGATTCTCAAGCAGAACTTTATGAAATGAAGAATAACAAGACAGCTAGCTTAGCCGCTCTTGTTTCA

GAAGGTCAAATCACGCAAAAACAGGCAGATTCATACAATGATTACTATGCGAAACATGGTGGCGAAAGCCGCTCAGTGGC

CAATTAG

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(14-34)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comYC	Streptococcus mutans UA140	69.231	96.296	0.667
comYC	Streptococcus mutans UA159	69.231	96.296	0.667
comYC	Streptococcus gordonii str. Challis substr. CH1	63.81	97.222	0.62
comGC/cglC	Streptococcus mitis SK321	62.264	98.148	0.611
comGC/cglC	Streptococcus mitis NCTC 12261	58.333	100	0.583
comGC/cglC	Streptococcus pneumoniae D39	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae R6	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae Rx1	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae TIGR4	58.491	98.148	0.574
comGC	Lactococcus lactis subsp. cremoris KW2	56.604	98.148	0.556
comYC	Streptococcus suis isolate S10	60.227	81.481	0.491
comGC	Staphylococcus aureus MW2	50	72.222	0.361
comGC	Staphylococcus aureus N315	50	72.222	0.361

Detailed information NTG0940286