Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | VKP55_RS06390 | Genome accession | NZ_CP142351 |
| Coordinates | 1264514..1264939 (-) | Length | 141 a.a. |
| NCBI ID | WP_011285575.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain SS1366 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1232079..1274295 | 1264514..1264939 | within | 0 |
Gene organization within MGE regions
Location: 1232079..1274295
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VKP55_RS06165 (VKP55_06165) | prx | 1232079..1232261 (-) | 183 | WP_011184907.1 | hypothetical protein | Regulator |
| VKP55_RS06170 (VKP55_06170) | sda3 | 1232499..1233299 (+) | 801 | WP_326673958.1 | streptodornase Sda3 | - |
| VKP55_RS06175 (VKP55_06175) | - | 1233571..1234005 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| VKP55_RS06180 (VKP55_06180) | - | 1234055..1234921 (-) | 867 | WP_011888701.1 | DUF334 domain-containing protein | - |
| VKP55_RS06185 (VKP55_06185) | - | 1234909..1235433 (-) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| VKP55_RS06190 (VKP55_06190) | - | 1235573..1236778 (-) | 1206 | WP_011888700.1 | glucosaminidase domain-containing protein | - |
| VKP55_RS06195 (VKP55_06195) | - | 1236766..1236888 (-) | 123 | WP_029713948.1 | hypothetical protein | - |
| VKP55_RS06200 (VKP55_06200) | - | 1236890..1237345 (-) | 456 | WP_011184730.1 | phage holin family protein | - |
| VKP55_RS06205 (VKP55_06205) | - | 1237355..1237987 (-) | 633 | WP_011888699.1 | hypothetical protein | - |
| VKP55_RS06210 (VKP55_06210) | - | 1237990..1238421 (-) | 432 | WP_002983467.1 | DUF1617 family protein | - |
| VKP55_RS06215 (VKP55_06215) | - | 1238433..1240319 (-) | 1887 | WP_014635603.1 | gp58-like family protein | - |
| VKP55_RS06220 (VKP55_06220) | - | 1240332..1241339 (-) | 1008 | WP_326673965.1 | hyaluronoglucosaminidase | - |
| VKP55_RS06225 (VKP55_06225) | - | 1241336..1243480 (-) | 2145 | WP_014635605.1 | phage tail spike protein | - |
| VKP55_RS06230 (VKP55_06230) | - | 1243477..1244193 (-) | 717 | WP_011888697.1 | distal tail protein Dit | - |
| VKP55_RS06235 (VKP55_06235) | - | 1244190..1247450 (-) | 3261 | WP_029714384.1 | tape measure protein | - |
| VKP55_RS06240 (VKP55_06240) | - | 1247440..1248021 (-) | 582 | WP_011888696.1 | bacteriophage Gp15 family protein | - |
| VKP55_RS06245 (VKP55_06245) | - | 1248025..1248459 (-) | 435 | WP_011888695.1 | hypothetical protein | - |
| VKP55_RS06250 (VKP55_06250) | - | 1248503..1248964 (-) | 462 | WP_011018120.1 | phage tail tube protein | - |
| VKP55_RS06255 (VKP55_06255) | - | 1248964..1249362 (-) | 399 | WP_011888694.1 | minor capsid protein | - |
| VKP55_RS06260 (VKP55_06260) | - | 1249359..1249715 (-) | 357 | WP_010922083.1 | minor capsid protein | - |
| VKP55_RS06265 (VKP55_06265) | - | 1249715..1250047 (-) | 333 | WP_011888693.1 | minor capsid protein | - |
| VKP55_RS06270 (VKP55_06270) | - | 1250037..1250453 (-) | 417 | WP_011888692.1 | hypothetical protein | - |
| VKP55_RS06275 (VKP55_06275) | - | 1250507..1251325 (-) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| VKP55_RS06280 (VKP55_06280) | - | 1251329..1251943 (-) | 615 | WP_011888690.1 | hypothetical protein | - |
| VKP55_RS06285 (VKP55_06285) | - | 1252069..1252335 (-) | 267 | WP_011888689.1 | hypothetical protein | - |
| VKP55_RS06290 (VKP55_06290) | - | 1252422..1252649 (-) | 228 | WP_010922077.1 | hypothetical protein | - |
| VKP55_RS06295 (VKP55_06295) | - | 1252649..1254142 (-) | 1494 | WP_014635607.1 | phage minor capsid protein | - |
| VKP55_RS06300 (VKP55_06300) | - | 1254147..1255649 (-) | 1503 | WP_010922075.1 | phage portal protein | - |
| VKP55_RS06305 (VKP55_06305) | - | 1255663..1256954 (-) | 1292 | Protein_1203 | PBSX family phage terminase large subunit | - |
| VKP55_RS06310 (VKP55_06310) | - | 1256957..1257433 (-) | 477 | WP_010922073.1 | hypothetical protein | - |
| VKP55_RS06315 (VKP55_06315) | - | 1257776..1258942 (-) | 1167 | Protein_1205 | DNA modification methylase | - |
| VKP55_RS06320 (VKP55_06320) | - | 1259578..1260012 (-) | 435 | WP_023611354.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| VKP55_RS06325 (VKP55_06325) | - | 1260327..1260626 (-) | 300 | WP_032467177.1 | hypothetical protein | - |
| VKP55_RS06330 (VKP55_06330) | - | 1260650..1261369 (-) | 720 | WP_111687971.1 | DUF1642 domain-containing protein | - |
| VKP55_RS06335 (VKP55_06335) | - | 1261366..1261659 (-) | 294 | WP_011888761.1 | hypothetical protein | - |
| VKP55_RS06340 (VKP55_06340) | - | 1261656..1261841 (-) | 186 | WP_011184603.1 | hypothetical protein | - |
| VKP55_RS06345 (VKP55_06345) | - | 1261866..1262093 (-) | 228 | WP_023611236.1 | hypothetical protein | - |
| VKP55_RS06350 (VKP55_06350) | - | 1262097..1262582 (-) | 486 | WP_023611207.1 | class I SAM-dependent methyltransferase | - |
| VKP55_RS06355 (VKP55_06355) | - | 1262586..1262870 (-) | 285 | WP_326673982.1 | hypothetical protein | - |
| VKP55_RS06360 (VKP55_06360) | - | 1262867..1263037 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| VKP55_RS06365 (VKP55_06365) | - | 1263034..1263270 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| VKP55_RS06370 (VKP55_06370) | - | 1263270..1263515 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| VKP55_RS06375 (VKP55_06375) | - | 1263512..1263868 (-) | 357 | WP_041174291.1 | hypothetical protein | - |
| VKP55_RS06380 (VKP55_06380) | - | 1263865..1264305 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| VKP55_RS06385 (VKP55_06385) | - | 1264305..1264508 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| VKP55_RS06390 (VKP55_06390) | ssb | 1264514..1264939 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| VKP55_RS06395 (VKP55_06395) | - | 1264932..1265606 (-) | 675 | WP_014635611.1 | ERF family protein | - |
| VKP55_RS06400 (VKP55_06400) | - | 1265607..1266089 (-) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| VKP55_RS06405 (VKP55_06405) | - | 1266111..1266365 (-) | 255 | WP_011018143.1 | hypothetical protein | - |
| VKP55_RS06410 (VKP55_06410) | - | 1266346..1266699 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| VKP55_RS06415 (VKP55_06415) | - | 1266840..1267622 (-) | 783 | WP_011888684.1 | ATP-binding protein | - |
| VKP55_RS06420 (VKP55_06420) | - | 1267609..1268370 (-) | 762 | WP_014635613.1 | DnaD domain protein | - |
| VKP55_RS06425 (VKP55_06425) | - | 1268464..1268601 (-) | 138 | WP_011017881.1 | hypothetical protein | - |
| VKP55_RS06430 (VKP55_06430) | - | 1268632..1268883 (-) | 252 | WP_011888682.1 | helix-turn-helix transcriptional regulator | - |
| VKP55_RS06435 (VKP55_06435) | - | 1268954..1269139 (-) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| VKP55_RS06440 (VKP55_06440) | - | 1269306..1269545 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| VKP55_RS06445 (VKP55_06445) | - | 1269643..1270362 (-) | 720 | WP_011888681.1 | phage antirepressor KilAC domain-containing protein | - |
| VKP55_RS06450 (VKP55_06450) | - | 1270390..1270602 (-) | 213 | WP_014635614.1 | DNA-binding protein | - |
| VKP55_RS06455 (VKP55_06455) | - | 1270800..1271141 (+) | 342 | WP_011888679.1 | helix-turn-helix domain-containing protein | - |
| VKP55_RS06460 (VKP55_06460) | - | 1271125..1271511 (+) | 387 | WP_023605207.1 | ImmA/IrrE family metallo-endopeptidase | - |
| VKP55_RS06465 (VKP55_06465) | - | 1271526..1272947 (+) | 1422 | WP_014635616.1 | DUF4041 domain-containing protein | - |
| VKP55_RS06470 (VKP55_06470) | - | 1273129..1274295 (+) | 1167 | WP_011018152.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15995.63 Da Isoelectric Point: 4.5748
>NTDB_id=925060 VKP55_RS06390 WP_011285575.1 1264514..1264939(-) (ssb) [Streptococcus pyogenes strain SS1366]
MINNIVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQEQRVYVTEVVAESFQMLESRNSQQQSGQDNSSQNDNSQPFGNSNPMDISDDDLPF
MINNIVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQEQRVYVTEVVAESFQMLESRNSQQQSGQDNSSQNDNSQPFGNSNPMDISDDDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=925060 VKP55_RS06390 WP_011285575.1 1264514..1264939(-) (ssb) [Streptococcus pyogenes strain SS1366]
ATGATTAACAACATTGTGCTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGAACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAGTTTCCAAATGTTGGAAAGTCGAAA
TAGCCAGCAACAATCTGGTCAAGATAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATA
TTTCAGACGATGATCTGCCGTTTTAA
ATGATTAACAACATTGTGCTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGAACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAGTTTCCAAATGTTGGAAAGTCGAAA
TAGCCAGCAACAATCTGGTCAAGATAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATA
TTTCAGACGATGATCTGCCGTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.294 |
100 |
0.667 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.07 |
100 |
0.66 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.972 |
100 |
0.44 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
43.262 |
100 |
0.433 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.262 |
100 |
0.433 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
51.786 |
79.433 |
0.411 |
| ssbA | Streptococcus mutans UA159 |
40.426 |
100 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
29.379 |
100 |
0.369 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
49.524 |
74.468 |
0.369 |